KEGG   Sesamum indicum (sesame): 105179272Help
Entry
105179272         CDS       T04135                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like isoform X2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00052  Galactose metabolism
sind00500  Starch and sucrose metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105179272
   00500 Starch and sucrose metabolism
    105179272
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105179272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 105179272
NCBI-ProteinID: XP_011101190
Position
Unknown
AA seq 621 aa AA seqDB search
MATPSSHAPPSYSPIPASSRRFKKQLLPSILYSSILLLPLVLVIVNRRPEGVSQVPPEKV
SRLISHGGLTFSWTNIMLSWQRTAYHFQPEKNWMNDPNGPLFHKGWYHLFYQYNQDSAIW
SNITWGHAVSRDLIHWLHLPCAMLPDQWYDINGVWTGSATILPDGRIMMLYTGNTHDLVQ
VQCLAYPANLSDPLLLEWVKYPNNPVMIPPPGIGHEDFRDPTTAWRSPGGDKWRITIGSK
VNKMGISLVYETADFFKYELLEGYLHEVPGTGMWECIDLYPISLKEANGLDTSANGPDIK
HVMKASLFDDGNDYYALGTYDPIENKWTPDDPELDVGVGLRYDYRKYYASKTFYDQNKKR
RILWGWIKETDAEELHILKGWACVQSIPRTVLFDPKTGNNILQWPVEEVESLRSDSFEFN
VKLEPGSVVPIEVDSGSQLDIVASFELDKEAFEETTEADVGYDCPTSGGSVNRGMLGPFG
IIILADENLLELTPIYFYIAKGHNRKVETHFCADELRSSVAADVDKIVYGSKVPVLDGEN
LTIRSLVDHSIVESFAQGGRRVITSRIYPTKAIDGEARIFLFNNSTGASVAAVETRVTAS
VKIWKMSSANIRPFPLEYGVN
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccctcctcccatgcgccgccttcctactcccccatccccgcctcctcccgg
cggttcaagaagcagctcctccccagcatcttgtattcatctatccttttgttgccatta
gtcctcgtgattgtcaacagaaggccagaaggggtgtcgcaggtaccgccggagaaggtc
tcccggctgattagccacggagggttgactttttcttggactaatattatgctgtcatgg
cagaggacggcttaccattttcaaccagaaaagaattggatgaatgatcctaatggtcca
ttgtttcataagggatggtatcacctgttctaccaatacaatcaagattcggctatttgg
agcaacatcacatggggccatgcagtatcaagggacctcatccactggctccaccttcct
tgtgcaatgctccctgatcaatggtacgatatcaacggagtttggacaggatccgccacg
atcctccccgatggtcggatcatgatgttgtacacaggaaacacccatgatctcgtgcag
gtgcagtgtctagcgtaccccgccaatctatccgatcccctccttcttgaatgggtcaag
tacccgaataacccggtcatgatccctccaccgggtattggccatgaggactttagggat
ccgacaactgcttggcgtagcccgggaggagacaagtggcggattacaattgggtcgaaa
gtcaataaaatgggtatttcacttgtttatgagactgctgacttcttcaagtatgagttg
ttggaggggtacttgcatgaagtcccgggcacgggtatgtgggagtgcatcgatctttac
ccgatttctttgaaggaagcaaacgggttggatacatcagctaatgggcccgatattaag
cacgtgatgaaagcaagtttgtttgatgacggaaatgattattatgcactcggaacatat
gacccgattgagaacaagtggactcccgatgacccggaattggacgtgggtgttggctta
agatatgactacaggaagtattatgcatcaaagacattttatgaccaaaataagaagagg
agaattttatggggttggatcaaagaaactgatgctgaagaacttcatatcctgaaaggc
tgggcttgtgttcagtctattccgaggaccgttttgtttgacccaaagacaggcaacaac
atactccaatggcctgtagaagaagtggagagcctgagatcagatagttttgagttcaac
gtaaagcttgaaccaggatcggttgtgccaattgaagtcgactcaggatcacagctggac
atagttgcctcatttgaattagacaaagaggcgtttgaggagacaactgaagcagacgtc
ggatatgactgccctacaagcggtggctctgttaataggggaatgttaggaccatttggc
atcatcattcttgctgatgaaaatctattggagttgacaccaatctacttttacattgct
aaagggcataacaggaaggtcgagactcatttttgtgctgatgagttgaggtcatcggta
gctgctgatgtggacaaaatagtttacgggagcaaagtccccgtgcttgatggtgaaaac
ttaaccattagatcattggtggatcactccattgtggagagctttgcacaaggaggaagg
agagtgatcacatcaagaatttaccctacaaaggccattgatggtgaagcacgcattttc
ctgttcaacaattccacgggagccagcgtcgctgctgttgagacgagggtgactgcatcc
gtcaagatctggaagatgagctccgcaaatattcgccccttccccttggaatatggagtt
aattaa

DBGET integrated database retrieval system