KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b57270Help
Entry
SS05631_b57270    CDS       T05069                                 

Definition
(GenBank) Glutathione synthetase-like protein
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00270  Cysteine and methionine metabolism
sino00480  Glutathione metabolism
sino01100  Metabolic pathways
Module
sino_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SS05631_b57270
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SS05631_b57270
Enzymes [BR:sino01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     SS05631_b57270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP RimK GSH-S_N ATPgrasp_YheCD ATPgrasp_ST TrkA_C ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ASY59819
UniProt: A0A249P3F8
Position
pSS05631b:complement(735346..736392)
Genome map
AA seq 348 aa AA seqDB search
MRIAFFVNSIEGEATYYTTTSLALAALSRGHEVCYVTPGDFVLRPDDSLLIRATTLTGSK
PKKPETLLASLRSAQEKVTTMEISEIQVLFLRNDPSEDADRRPWAVYVGTNFGRLAAARG
VIVVNDPDGLALAQNKLYFQGFPEVVRPTTMISRSIEEIRAFIDDHPDGVILKPLQGSGG
KNVFKIRSKDEANLNQIFEAASGTGYLIAQNYLPEAVGGDIRLFLMNGRPLEREGVYAAF
RRVPAKGDVRSNLHASGTAEPATVTPEILAIAEKLRPKLIEDGMFLVGLDIVGDRVLEAN
VFTPGGLPEIEAAHGVDFGEDIVMALEEKVRLQQLYQGALPNRTLATL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcctttttcgtcaactccatcgagggcgaggcaacgtattacacgacgacg
tcgctggcgttggcggcgctctcccgcggccacgaggtctgctatgtcacgccgggagac
ttcgtgctccgcccggacgacagcctgctcatccgcgcaacgaccctgaccggctccaaa
ccgaagaagccagaaacgctgctcgcgagcctcagaagcgctcaggagaaggtgaccacc
atggagataagcgagatccaggtgctcttcctcagaaacgatccctccgaggacgctgac
cggcgcccctgggccgtctatgtcgggaccaattttggacgcttggccgcggcccggggc
gtcatcgtcgtcaacgaccccgacggcttggcgctggcgcagaacaagctctatttccag
ggcttcccggaggtcgtgcgaccgacgacgatgatctccaggagcatcgaggaaatccgc
gccttcatcgacgaccatccggacggcgtgatcctgaaaccgctgcagggatccggtggc
aagaacgtattcaagatccgctccaaggacgaagccaacctcaaccagatcttcgaggcg
gcgagcggaaccggatacctgatcgcccagaactatcttccggaggcggtcggcggcgac
attcggcttttcctgatgaacggacggccgctcgagcgcgaaggcgtctatgccgccttc
cgacgcgtaccggcaaagggcgatgtccgctcgaacctgcacgccagcggcaccgccgaa
ccggcgaccgtcacaccggaaattctcgccatagccgaaaagctgcggcccaaactgatc
gaggacggtatgtttctggtcggactcgatatcgtcggcgaccgtgtcctggaagccaat
gtcttcacccctggcggcctgcccgaaatcgaagcggcgcacggggtcgatttcggcgag
gacatcgtcatggcgctggaggagaaggtgcggctgcagcagctctatcagggcgcgctc
cccaaccgcacgctggcgacactttga

DBGET integrated database retrieval system