KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c01430Help
Entry
SS05631_c01430    CDS       T05069                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
sino  Sinorhizobium sp. CCBAU 05631
Brite
KEGG Orthology (KO) [BR:sino00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SS05631_c01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASY55103
UniProt: A0A249NN35
Position
complement(142013..142414)
Genome map
AA seq 133 aa AA seqDB search
MSNMYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSEIAVRLMTRYWHITDE
NGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEDGETFNVAIPA
FSLDSPGLVRTLN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatgtaccgtgcgctgacacgcgacatagaggtcacggtggagccgtactat
ctcgaagaacaatcggatccggatgatagccgctatgtctggggctaccgcatcgtcatc
tcgaaccattccgaaatcgcggttcggctgatgacccgctactggcacatcaccgacgag
aacggccaggtggacgaggtcagcggtccaggcgtcatcggcgagcagccgctgctcaat
cccggcgacacctacgaatattcctccggctgcccgctcgacaccccctccggcgtcatg
ttcggccactacagcatggaggccgaagacggagagaccttcaatgtcgccatccccgcc
ttctcgctcgattctcccggactggtgcggacgctgaactaa

DBGET integrated database retrieval system