KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c06990Help
Entry
SS05631_c06990    CDS       T05069                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Brite
KEGG Orthology (KO) [BR:sino00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SS05631_c06990
Enzymes [BR:sino01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     SS05631_c06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_5 MTS Methyltransf_2 FtsJ Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: ASY55652
UniProt: A0A249NQ63
Position
complement(683323..684096)
Genome map
AA seq 257 aa AA seqDB search
MAWSAAQYVKFEDERTRPARDLLAQVPDLPPGPAFDLGCGPGNSTQLILERFPNNPLVGI
DSDEDMLEAARKRLLGLRFERVDLAGWTPPPGAALFFANAVFQWLPKHIDILERLVEALL
PGGTLAVQMPDNLDEPSHLLMQETAEERTFAAAFAGRTIRRMSLPSPRTYVERLAPKAAR
VEVWHTVYYHPLANANAIVEWVKGTGLRPYLDALPANRRKDYLAAYAEKIRREYPAMADG
RVLLRFPRLFLVAVKAP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtcggcagcgcaatatgtaaagttcgaggatgagcgaacccggccggcgcgc
gatctcctggcgcaggtccccgatctgccgcccggccccgccttcgacctcggctgcgga
ccgggcaattcgacgcaacttatcctcgaacgcttccccaacaatccgctcgtcggcatc
gacagcgacgaggacatgctggaggccgctcgcaaacggctgctcggcctgcgcttcgag
agggtcgatcttgccggctggacgccgccgccaggggccgcgcttttcttcgccaacgcc
gtcttccaatggctgccgaagcacatcgatatcctcgagcgtctcgtcgaggcgctgctg
ccgggcggaacgcttgcggtgcagatgcccgacaacctcgacgagccttcgcatctcctg
atgcaggagacggccgaggaacggactttcgcagcggcttttgccggccggacgatccgg
cgaatgtcgcttccctccccgaggacctatgtcgaaaggctggccccgaaggcggcgcgg
gtcgaggtctggcacacggtctattatcacccgctggccaacgcgaatgccatcgtcgag
tgggtgaagggcacgggcttgcgcccctatctcgatgcactgcctgccaaccggcgtaag
gactacctcgccgcctatgctgagaagatccgcagggaatatccggccatggccgacggg
cgggtgctcctgcgctttccccgcctgttcctcgtcgccgtaaaggcgccctga

DBGET integrated database retrieval system