KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c09260Help
Entry
SS05631_c09260    CDS       T05069                                 

Definition
(GenBank) Aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sino00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SS05631_c09260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sino01007]
    SS05631_c09260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sino03016]
    SS05631_c09260
   03029 Mitochondrial biogenesis [BR:sino03029]
    SS05631_c09260
Enzymes [BR:sino01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     SS05631_c09260
Amino acid related enzymes [BR:sino01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SS05631_c09260
Transfer RNA biogenesis [BR:sino03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SS05631_c09260
 Prokaryotic Type
   Other AARSs
    SS05631_c09260
Mitochondrial biogenesis [BR:sino03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SS05631_c09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ASY55878
UniProt: A0A249NQE9
Position
903586..905478
Genome map
AA seq 630 aa AA seqDB search
MTNPAHHALFRPTLAMPPRPPWRASRGHLQFQDQTMHRYRSHTCAALRKSDVGSTVRLSG
WVHRVRDHGGVLFIDLRDHYGITQVVADPDSPAFKMAETVRGEWVIRIDGTVKARTDETV
NKNMPTGEIELYAREIEVLSAAKELPLPVFGEPDYPEDVRLKYRFLDLRRETLHKNIIKR
TEVIAAMRRGMTDIGFTEYTTPILTASSPEGARDFLVPSRIHPGTFYALPQAPQQYKQLL
MVAGFDRYFQIAPCFRDEDPRADRLPGEFYQLDLEMSFVEQEDVWDTMEPMIRAIFSDFA
GGKPVTEKFQRIPYDTAIRKYGSDKPDLRNPIEMQDVTRHFAGSGFKVFANMIASNPKVE
IWAIPAKTGGSRAFCDRMNAWAQSQGQPGLGYIFWRKESEKLEGAGPLAKNIGEERTDAI
RTQLGLEDGDACFFVAGEPAKFYKFAGEARTKAGEELNLVDRDRFELCWIVDFPFYEWNE
DEKRVDFAHNPFSMPQGGLEALSGDDLLSIKAFQYDMVCNGFEIASGSIRNQSPELMVKA
FENVGLSQADVEAQFGGLYRAFQYGAPPHGGMAFGIDRIVMLLVGAKNLREISLFPMNQQ
AVDLLMGAPSPATPAQLRELAIRPIPQKKD
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaatccggcgcatcatgcgcttttccgcccgactttggctatgccgccgcgcccg
ccttggcgagcctcgcgcggccatttgcaattccaggaccagacgatgcaccgttaccgc
agccacacctgtgccgctctccgcaagtcggatgtcggctccaccgttcgcctttccggc
tgggttcaccgcgtccgcgaccatggcggcgtgctcttcatcgacctgcgcgaccattat
ggcatcacccaagtcgtcgccgatccggattcgcccgccttcaagatggcggaaaccgtg
cgcggtgaatgggtcatccgcatcgacggaaccgtgaaggcgcgcaccgacgagaccgtc
aacaagaacatgccaaccggcgagatcgagctctatgcccgcgagatcgaggtgttgtcg
gccgccaaggagttgccgctgccggtcttcggcgagccggactatccggaagacgtgcgc
ctcaagtaccgcttcctcgatctgcgccgcgagacgctgcacaagaatatcatcaagcgc
accgaggtcattgccgccatgcgccggggaatgaccgacatcggcttcaccgaatatacg
acgccgatcctgacggcttcgtcgccggagggcgcgcgcgacttcctcgtgccgagccgc
attcatcccggtactttctacgcactgccgcaggcgccgcagcagtacaagcagctcctg
atggttgccggcttcgaccgctatttccagatcgcgccgtgcttccgggacgaggacccg
cgtgccgaccggctgccgggcgaattctaccagctcgacctggagatgagcttcgtcgag
caggaagacgtctgggacacgatggagccgatgatccgcgcgatcttttcggatttcgcc
ggcggcaagcccgtcaccgaaaagttccagcgcattccctatgacacggcgatccgcaaa
tatggatccgacaagccggatctgcgcaacccgatcgagatgcaggacgtcacccggcat
ttcgccggctccggcttcaaggtctttgccaacatgattgcctccaacccgaaggtggaa
atctgggctattccggccaagaccggcggcagccgcgccttctgcgaccgcatgaacgcc
tgggcccagagccagggccagcccggcctcggctatatcttctggcgcaaggaaagcgag
aagctcgaaggggcaggcccgctcgccaagaacatcggcgaggagcgcaccgatgcgatc
cgcacgcagctcggcctcgaggatggcgacgcctgcttcttcgtcgccggcgagccggcc
aagttctacaaattcgccggcgaagcccgcaccaaggccggcgaggagctgaacctcgtc
gatcgcgaccgcttcgaactgtgctggatcgtcgacttcccgttctatgaatggaacgag
gacgagaagcgcgtcgacttcgcccataacccgttctcgatgccgcagggcggcctcgag
gcgctctcgggcgacgacctgctgtcgatcaaggcattccagtacgacatggtctgcaac
ggcttcgaaatcgcatccggctcgatccgtaaccagtcgccggagctgatggtcaaggcc
ttcgagaatgtcggcctcagccaggcggatgtcgaagcgcagttcggcggtctctaccgc
gccttccaatacggcgccccgccgcatggtggcatggccttcggcatcgaccgaatcgtc
atgctgctggtcggagccaagaacctgcgcgagatctcgctgttcccgatgaaccaacag
gcggtcgatctgttgatgggtgcgccgtcgccggcaacgccggcgcagctgcgcgaactg
gcgatccggccgatcccgcagaaaaaggactga

DBGET integrated database retrieval system