KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c17670Help
Entry
SS05631_c17670    CDS       T05069                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00450  Selenocompound metabolism
sino00970  Aminoacyl-tRNA biosynthesis
sino01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SS05631_c17670
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SS05631_c17670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sino01007]
    SS05631_c17670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sino03016]
    SS05631_c17670
Enzymes [BR:sino01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SS05631_c17670
Amino acid related enzymes [BR:sino01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SS05631_c17670
Transfer RNA biogenesis [BR:sino03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SS05631_c17670
 Prokaryotic type
   Other AARSs
    SS05631_c17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ASY56700
UniProt: A0A249NSL0
Position
complement(1666476..1668026)
Genome map
AA seq 516 aa AA seqDB search
MRDTSPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGREVFFLTGTDEHGQKMQQ
TARKEGISPQELADRNSAEFEKMAELLNASNDDFIRTTEKRHHEASQAIWIRMGEAGDLY
KDAYAGWYSVRDEAYYQENETELRDDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLKLY
EDNPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIRVPNDPAHVMYVWVDALTNYLT
ATGYLADPSGPRAKFWPANIHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKG
EKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGN
LASRSLSMIVKNCDAQVPVCGPLTDEDKAMLVAADSLLDTTRVEMGKQLIHRALAAIIAV
VSETDRYFAGQEPWALKKTDPERMGTVLYVTAEVVRQIAILLQPFMPESAGKLLDLVAVP
EERRSFADLGEPGRLVPGTPLEAPKPVFPRYVAPEA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagagatacgtccccgttctacatcaccaccgcgatttcttacccgaacggcaagccg
catatcggccacgcctatgagctgatcgcgacggacgccatggcgcgctatcagaggctg
gacgggcgcgaggtcttcttcctgacggggaccgatgaacacggccagaagatgcagcag
acggcacgcaaagagggcatctcgccgcaggagcttgccgaccgcaactcggccgagttc
gaaaagatggccgaactgctcaacgcgtcgaacgacgacttcatccgcacgacggagaag
cgtcatcacgaggcgtcgcaggcaatctggatccgcatgggcgaggcaggtgacctttac
aaggacgcctatgccggctggtactctgttcgcgacgaggcctattaccaggaaaacgag
acggaactgcgcgacgacggtgtgcgctacgggccgcagggaacgccggtcgagtgggtg
gaggaggagagctacttcttccgtctgtcggcctatcaggacaagctcctcaaactctac
gaggacaaccccgatttcatcggccccgccgagcggcgcaacgaggtgatctccttcgtc
aagtcgggcctgaaggatctgtcggtctcgcgcacgaccttcgactggggcatccgggtg
ccgaacgatcctgcccatgtcatgtatgtctgggtggacgccttgacgaactatctcacc
gcgacgggctatttggccgatccgtcgggaccgcgggcaaagttctggccggcgaatatc
cacgtcatcggcaaggacatcatccgcttccatgccgtctactggccggctttcctgatg
tcggcgggcctgccgctgccgaaacgcgtcttcgcgcatggtttcctgctcaacaagggc
gagaagatgtcgaagtcgctcggcaacgtggtcgacccgttcaacctcgtcgaacatttc
ggcttggaccagatccgctatttcttcctgcgggaagtctccttcggccaggacggcagc
tacagcgaggagggaatcgcgacccgcatcaattccgacctagccaacggtatcggcaat
ctcgccagccgctctctgtccatgatcgtcaagaactgcgacgcccaggttccggtctgc
ggtccgctgacggacgaggataaggcgatgctcgttgccgccgattcgctcctcgatacg
acgcgtgtggaaatgggcaagcagctcatccaccgcgcgctcgccgcgatcattgccgtg
gtttccgagacggaccgctatttcgccgggcaggaaccctgggcgctcaagaagactgat
ccggagcgcatggggaccgtgctctacgtgacggcggaggtggtgcgccagatcgcgatc
ctgctgcagcccttcatgcccgaatcggcgggcaagctcttggatctggtggcggtcccc
gaagaaaggcggagtttcgccgaccttggcgagccgggccgcctggttcccggcacgccg
ctcgaggcgccgaagccggtctttccgcgctacgttgcaccggaagcgtaa

DBGET integrated database retrieval system