KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c24590Help
Entry
SS05631_c24590    CDS       T05069                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00670  One carbon pool by folate
sino01100  Metabolic pathways
sino01120  Microbial metabolism in diverse environments
sino01200  Carbon metabolism
Module
sino_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SS05631_c24590
Enzymes [BR:sino01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SS05631_c24590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ASY57389
UniProt: A0A249NWH0
Position
complement(2347599..2349278)
Genome map
AA seq 559 aa AA seqDB search
MGEVKSDIEIARAARKQSIMEIGAKLGIPPEHLLPYGHDKAKVSAEFIAAQKDKRDGRLI
LVTAINPTPAGEGKTTTTVGLGDGLNRIGKKTIVCIREASLGPCFGIKGGAAGGGYAQVV
PMEDINLHFTGDFHAITSAHNLLAALIDNHIYWGNEQAIDIRRIAWRRVMDMNDRALRQI
IGSLGGVANGYPRETGFDITVASEVMAILCLAADIKDLEKRLGNIIIGYRRDKSPVYARD
IKADGAMAVLLRDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVVATTTALKLADYVVT
EAGFGADLGAEKFFDIKCRKAGLKPDAAVVVATVRAIKMNGGVKKDDLGKENLEAVRKGC
ANLGRHVQNVKKFGVPVLVAINHFTSDTEAEIRAIKDYVRTLGSEAILCRHWAEGSAGIE
ELAHKVVDLANAGHSQFSPLYPDDMPLFHKIETIAKDIYHASEVIADKVVRDQLRTWEDQ
GYGQLPICMAKTQYSFSTDPNLRGAPSGHAVPIREVRLAAGAGFVVVITGEIMTMPGLPK
VPSSEKIRLNEAGYIEGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggtcaagtccgacatcgaaatcgcgcgtgctgcgcgcaagcaatcgatcatg
gagatcggggctaaactcggcattccgccggagcatctgctgccttacggccatgacaag
gcgaaggtcagcgccgagttcattgccgcgcagaaggataagagagacggccggctgatc
ctggtgacggcgatcaacccgacgccggccggcgagggcaagacgacgaccaccgtcggc
ctcggcgacggcctcaaccgcatcggcaagaagacgatcgtctgcattcgcgaggcctcg
ctcggtccctgcttcggcatcaaggggggtgctgccggcggcggctatgcgcaggtggtg
ccgatggaggatatcaacctgcacttcaccggcgatttccacgccatcacctcggcccac
aacctgctcgccgcgctgatcgacaatcacatctattggggcaacgagcaggcgatcgac
attcgccgcatcgcctggcggagggtgatggacatgaacgatcgggcgttgcgccagatc
atcggctcgctcggcggtgtcgccaatggctatccgcgcgagaccggcttcgacattacc
gtcgcttccgaggtcatggcgatcctgtgccttgccgccgacatcaaggatctggaaaaa
cgcctcggcaacatcatcatcggctaccggcgcgacaagagcccggtctatgcgcgcgac
atcaaggcggacggggcgatggcggtgttgctcagggatgcgatgcagccgaacctggtg
cagacgctcgagaacaatccggcctttgtccatggcggcccctttgccaatatcgcgcat
ggctgcaactcggtggtggcaacgacgacggcgctgaagcttgccgactacgtcgtgacc
gaagccggtttcggagcggatctcggcgccgagaaattcttcgacatcaagtgccgcaag
gccggcctgaagccggacgccgccgtcgtcgtcgccaccgtcagggcgatcaagatgaat
ggcggcgtgaagaaggacgatctcggcaaggagaatctcgaggcggtcaggaagggatgc
gccaacctcggccgccacgtgcagaacgtcaagaaattcggcgtgccggtgctcgtcgcg
atcaaccacttcacctccgatacggaggcggaaatccgggcgatcaaggactatgtcagg
acgctcggttccgaggcgatcctgtgccggcactgggccgagggatcggccggcatcgag
gaactggcgcacaaggtcgtcgatctcgccaatgccggacactcgcagttctcgccgctc
tatccggacgacatgccgctcttccacaagatcgagacgatcgccaaggacatctatcac
gccagtgaagtgattgccgacaaggtggtgcgggatcagctgagaacctgggaggaccag
ggctacgggcaactgccgatctgcatggcgaagacgcaatattccttctccaccgacccc
aacctgcgcggcgctccgagcggccatgcggtgccgatccgcgaagtccgccttgcggcc
ggagccggcttcgtcgtcgtcatcaccggcgagatcatgacgatgccgggcctgccgaag
gtgccgtcctcggagaagatccgcctcaacgaggcgggctacatagaggggctgttctga

DBGET integrated database retrieval system