KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c28410Help
Entry
SS05631_c28410    CDS       T05069                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00010  Glycolysis / Gluconeogenesis
sino00053  Ascorbate and aldarate metabolism
sino00071  Fatty acid degradation
sino00280  Valine, leucine and isoleucine degradation
sino00310  Lysine degradation
sino00330  Arginine and proline metabolism
sino00340  Histidine metabolism
sino00380  Tryptophan metabolism
sino00410  beta-Alanine metabolism
sino00561  Glycerolipid metabolism
sino00620  Pyruvate metabolism
sino00625  Chloroalkane and chloroalkene degradation
sino00903  Limonene and pinene degradation
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS05631_c28410
   00053 Ascorbate and aldarate metabolism
    SS05631_c28410
   00620 Pyruvate metabolism
    SS05631_c28410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SS05631_c28410
   00561 Glycerolipid metabolism
    SS05631_c28410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SS05631_c28410
   00310 Lysine degradation
    SS05631_c28410
   00330 Arginine and proline metabolism
    SS05631_c28410
   00340 Histidine metabolism
    SS05631_c28410
   00380 Tryptophan metabolism
    SS05631_c28410
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SS05631_c28410
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SS05631_c28410
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SS05631_c28410
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SS05631_c28410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASY57770
UniProt: A0A249NVP7
Position
2728791..2730221
Genome map
AA seq 476 aa AA seqDB search
MTITERGTQFYIGGEWQEHADATSLPVVDPASERVVGHIAAGEANHVDLAVAAARKAFPA
FSQSSVPERLELLGRVHSLLKERAELFAEALVMEMGAAISFARASQVPFAAEHIRVQMEV
LENYRFVTVDGRTATAKEPIGVCALITPWNWPLYQITAKAAPAIAAGCTVVLKPSELSPY
SALLFAQLMHDAGTPPGVFNLVNGTGESVGAALSSHPEVDMISITGSTRAGVLVAQAAAP
TVKRVVQELGGKSPNILLDDADFAQAVPKGVLAGMRNVGQSCSAPTRMLVPAHRLAEVED
LASKTAHAIRVGDPRDPATTMGPIANRAQYERVQTMIRAGIDEGAKLLCGGLGRPAGLDR
GFFTQPTIFSEVRPEMRVAREEIFGPVLAIMPYRDEEEAITIANGTVYGLGAHVQSPDPE
RSRRVAARIRAGQVHINYPAWDGTAAFGGYKHSGNGREYGVHGLEEYLETKSILGY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaccgaacgaggaacccagttctatattggcggggagtggcaagaacacgcg
gacgcaacaagtctgcccgtcgttgatcccgcctcggaacgggttgtcggacatatcgcc
gccggagaggcaaaccacgtcgatctcgcggttgcggcagcgcgcaaggccttcccggcc
ttctctcaatcatctgtgcccgagaggcttgagctcctcggcagggtgcattcgctcctg
aaggagagagcggagctgttcgccgaagcgctcgtgatggagatgggggcggcgatcagc
tttgcgcgggcctcacaggttccttttgccgcggaacacattcgtgtccagatggaggtg
ctcgagaactaccggttcgtgacggtcgatgggcgcaccgcaacggccaaggagccgatc
ggcgtttgcgccctgatcaccccgtggaactggccactctaccagatcaccgccaaggcc
gccccggccatcgcggcgggctgcaccgtcgtcctcaaacccagcgagctgtccccctac
agcgccttgctcttcgcccaactgatgcatgatgccggcactccgccaggcgtgttcaac
ctggtcaatggcactggagagagtgtcggcgcagctctctccagccacccagaggtcgac
atgatctcaatcaccggctcgacgcgtgcgggggtactcgtcgcgcaggcggcggccccg
acggtcaagcgggtggtccaggaacttggcggcaaatcacccaacatcctgctcgatgat
gctgatttcgcccaggcggtaccgaaaggcgtccttgccggaatgcgcaatgtcggccag
tcgtgcagcgccccgacacgcatgctcgtgcccgcccatcggctcgccgaggtcgaggat
ctggccagcaaaaccgcacatgccatccgcgtcggcgatccgagggatccggcgaccacc
atggggcccatcgccaatcgcgcccagtatgagcgggtgcagaccatgatccgggcggga
atcgacgaaggcgcgaagctcctgtgcggcggactgggacgcccggcaggtctcgatcga
ggcttcttcacgcagccgacgattttttccgaggttcggccagagatgcgcgtcgctcgc
gaggagatctttgggccggtccttgcgatcatgccctaccgggacgaagaagaggcaatc
acgatcgccaacggcacggtctatggactgggagcccatgtccagtccccggatccggag
cggtctcgacgagtcgccgcgcggatccgcgccgggcaggttcacatcaactatccggcg
tgggacgggacggccgcgttcggtggctacaagcactcgggcaatgggcgcgaatatggc
gtgcatgggcttgaggagtatctcgagacgaagtccatcctgggctattga

DBGET integrated database retrieval system