KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c28500Help
Entry
SS05631_c28500    CDS       T05069                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00260  Glycine, serine and threonine metabolism
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
sino01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SS05631_c28500
Enzymes [BR:sino01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SS05631_c28500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ASY57779
UniProt: A0A249NXM5
Position
complement(2736876..2737910)
Genome map
AA seq 344 aa AA seqDB search
MQTPVIRLDFRSDTVTRPTLGMRAAMAAAEVGDDVLGDDPTIKALEARLAALFGKEAGLF
MPTGTMSNLAAIMSHCQRGEEFLCATGAHTYLWEAGGAAVLGSVQPQPLPVRADGTIPIE
DLHAAVKDDDPHFAITRLVTIENTFAGRVLPRDHLAEVLEFARERKLATHLDGARLFNAA
AALGVDVGYLAEGFDSVSLCLSKGLGAPLGSVLVGDAPLIARARRWRKMLGGGMRQAGII
AAAGLYALDHHVDRLAEDHANARVLAQAFAGIEGLKVTPPQSNVVFVELAPYLATRLSEA
LRELGIGASFWPGGRMRWVTHLDVNRAAVDEAIAAVREITEGRT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacctgtcatccgccttgatttccgttccgatacggtcacccgtccaaccctt
ggcatgcgtgcggcgatggctgccgccgaggtgggcgacgatgtccttggcgacgatccc
acgatcaaggcgctcgaggcccgacttgccgcactgttcggcaaggaagcgggactgttc
atgccaaccggcaccatgtccaatctcgctgcgatcatgagccattgccagcgcggcgag
gaatttctctgcgcaaccggagctcatacctatctgtgggaagccgggggcgctgcggtg
ctgggctcggtccagccgcaacccttgccggtgcgcgccgacgggacaatccccatcgag
gaccttcacgccgcggtgaaggacgacgatccgcattttgcgatcacgcgactggtcacc
atcgagaacacgttcgccgggcgggtcctgccgcgcgatcatctggccgaggtcctcgaa
tttgcgcgggagcggaagctcgccacccatctcgatggtgcgcggctgttcaatgcggct
gcggcgctcggcgttgatgtcgggtacctggcagagggcttcgatagcgtgtcgctgtgc
ctttcaaaggggctgggggcgccgctcggatcagtgctggtcggcgatgccccattgatc
gcccgtgcgcgccggtggcggaagatgcttggcggcggaatgcggcaggcagggataatt
gcggcggctgggctgtacgcgctcgaccaccacgtcgaccggctggccgaggaccacgcc
aatgctcgggtgctcgcgcaagcatttgcgggaattgaggggctgaaggtgaccccgccg
caatcaaacgtggtctttgtcgagctcgcgccctatctggcgacccggctgtccgaggcg
ctacgtgaactcggcatcggggcgagtttctggcccggtgggcgcatgcgctgggtcacc
catctcgatgtcaaccgtgccgctgtcgacgaggccatcgcggcagtgcgcgagatcact
gagggccggacatga

DBGET integrated database retrieval system