KEGG   Streptococcus iniae ISNO: DW64_01810Help
Entry
DW64_01810        CDS       T03286                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00620  Pyruvate metabolism
sio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DW64_01810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sio02000]
    DW64_01810
Enzymes [BR:sio01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     DW64_01810
Transporters [BR:sio02000]
 Other transporters
  Primary active transporters [TC:3]
   DW64_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AHY17114
Position
343862..345250
Genome map
AA seq 462 aa AA seqDB search
MAKIRITETSLRDGQQSQIATRMTTEQMLPILEELDNAGYHALEVWGGATFDACLRFLNE
DPWERLRTIRKAVKKTKLQMLLRGQNILGYRNYADDVVREFVKKSIENGIDIIRVFDALN
DSRNLQTAVAATKEFGGHAQVAISYTTSPVHTVDYFIKLAQEYAALGADSICIKDMAGVL
TPQTGYDLVKGIKELVDLPIEVHTHATSGISEMTYLKVAEAGADIIDTAVSSFAGGTSQP
ATESVVMGLEDLGFETGIDLKRVENVATYLNGVRDHFRNEGLLNPKIKDVDPKTLIYQVP
GGMLSNLLSQLTEQGLADKYEEVLIEVPKVRADLGYPPLVTPLSQMVGTQALMNIIAGER
YKVVPNEIKDYVRGLYGRPPAPLAPGMKEKIIGDEEVITIRPADLLAPQLKALAEEIACY
ARSEEDVLSYASFPQQAKDFLGRCEDPFYDVPLQTVTVSIDI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataaggataaccgaaacctctcttagagatggacaacaaagtcaaattgcg
actcgaatgacaaccgagcaaatgctaccaatccttgaagaacttgataatgctggttac
catgcattagaagtctggggaggagcaacctttgatgcttgccttcgttttttaaatgaa
gacccatgggaaaggttacgtacgattcgtaaagctgttaaaaaaacaaaattgcagatg
cttttacggggccaaaatatcctgggttaccgtaattatgcagatgatgttgtcagagaa
tttgtcaaaaaatcgattgaaaatggtattgatatcattcgtgtctttgatgctttgaat
gattcacgaaatttacaaacagcagttgctgctacaaaagaattcggtggacatgcccag
gtagctatttcttacaccacaagtccagttcacacggtagattattttattaaactggct
caagaatatgcagcacttggcgcagattcaatctgcattaaagatatggcaggtgtttta
acacctcaaactggctatgatcttgttaaagggattaaagagcttgttgacctccctatt
gaagttcacacgcatgcaacaagtggtatttcagaaatgacttatcttaaagttgctgaa
gcaggtgcagatattattgatacagctgtctcatcttttgcgggaggaactagccaacct
gcaacagaatctgttgttatgggcttggaagaccttggttttgaaacagggattgattta
aaacgtgttgaaaatgtggcaacatatcttaatggggtcagagatcactttcgtaacgag
ggacttctcaatcctaaaattaaagatgttgaccctaaaaccctgatttaccaggttcca
ggcggtatgctatcaaatctattaagtcaattaacagaacaaggcttggctgataaatat
gaagaagttcttattgaagtgccaaaagtaagagcagatttaggttacccacctcttgtt
accccgctatctcaaatggtgggaacccaggctttaatgaatattattgcaggtgagcgg
tataaggttgttccaaatgaaattaaagattatgttcgaggactctatggacgccctcct
gcaccacttgctcctggcatgaaagaaaaaattataggggatgaagaggttattaccatc
agaccggctgatttacttgctccgcaattaaaggcattagctgaagaaattgcttgttat
gcaagaagtgaagaagacgtcttaagttatgcttctttccctcaacaggcaaaagacttt
ttgggacgatgcgaagacccattttacgacgtccctcttcaaacagtcacagttagcatt
gatatctaa

DBGET integrated database retrieval system