KEGG   Streptococcus iniae ISNO: DW64_05290Help
Entry
DW64_05290        CDS       T03286                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00900  Terpenoid backbone biosynthesis
sio01110  Biosynthesis of secondary metabolites
sio01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DW64_05290
Enzymes [BR:sio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     DW64_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AHY17745
Position
1065405..1066682
Genome map
AA seq 425 aa AA seqDB search
MTSKINWSGFHKKTPHDRLVFLQDNHLLSEQLQEKLKLDELLTLDTANQMAENVIGRLAL
PFSIAPDFLINSKTYHVPFVTEEPSVVAAAAFAAKIMKRTGGFKTKVHDRQMIGQVALYD
IKEMALAQRAIIEASEQLITLANQAYPSIVKRGGGARRIKVDIKEDFLLVYMTVDTQEAM
GANMVNTMMEALSPELERLTQGKTLMAILSNYATESLVSAECCLPLRFLSRDPKEAHQLA
HKMALASQLAQIDPYRAATHNKGILNGIDAVVMATGNDWRAIEAGSHAYAAKDHAYKGLT
QWYFNADKGVIEGYITLPMPIATKGGSIGLNPSVMIAHDLLGHPTAKELAQIIAAVGLAQ
NFAALKALTNSGIQAGHMKLQAKSLALLAGANESELPQLLTRLLNEKHMNQETAQLLLKN
LRQEK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaatcaactggagtggctttcacaaaaagacacctcacgaccgtcttgta
ttcttacaagacaatcacctcttatctgagcaacttcaagaaaagctaaagcttgacgag
ttacttactttagatactgctaatcaaatggccgaaaacgtgattggtagactggctctg
ccttttagcatcgcccctgattttctcatcaatagcaaaacttaccatgtcccatttgtg
accgaagagccttctgtcgtagctgctgctgcctttgctgccaaaatcatgaaacgcact
ggaggcttcaaaaccaaagtccatgaccgacaaatgattggacaggtcgcactttatgat
atcaaagaaatggctcttgcccaaagggcaatcatagaagcttctgaacagctgattacc
ctagccaatcaagcctatccttctattgtcaaaagaggaggcggtgctagaagaattaaa
gtagacattaaagaagattttctccttgtttatatgacagttgatacccaagaagctatg
ggagcaaatatggttaataccatgatggaagccttgtcccctgagcttgaaagactgact
caggggaaaacactcatggctattctttcgaattatgctacagagtcccttgtttctgca
gagtgttgtttgcccttgagatttctgagtcgtgacccaaaagaagctcaccaattggca
cataagatggcattggcaagtcagttagcccagattgatccttaccgtgcagctacacat
aataaaggaattctaaatggcattgatgctgtggttatggctactggaaacgactggcga
gcaatagaagctggtagccatgcttatgctgctaaagatcatgcttacaaaggcctaaca
caatggtattttaatgccgataaaggggtgattgaaggttacatcactctccccatgcca
atagcaacaaaagggggctctattgggctaaatccaagtgttatgattgctcatgaccta
ctaggccacccaacagctaaagaattagctcaaatcattgcagcagttggcttagcgcaa
aactttgctgcccttaaagcactaacaaattcgggcatccaagcaggacatatgaaatta
caagcaaaatcattagcacttctagctggggctaatgaatcagaacttcctcagcttctc
acacgtttacttaatgaaaaacatatgaatcaagaaactgctcaattactattaaaaaac
ttaagacaagaaaaataa

DBGET integrated database retrieval system