KEGG   Streptococcus sp. I-P16: N597_02130Help
Entry
N597_02130        CDS       T02880                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00450  Selenocompound metabolism
sip00970  Aminoacyl-tRNA biosynthesis
sip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    N597_02130
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N597_02130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sip01007]
    N597_02130
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sip03016]
    N597_02130
Enzymes [BR:sip01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     N597_02130
Amino acid related enzymes [BR:sip01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   N597_02130
Transfer RNA biogenesis [BR:sip03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    N597_02130
 Prokaryotic type
   Other AARSs
    N597_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGY37754
UniProt: U5P257
Position
401932..403923
Genome map
AA seq 663 aa AA seqDB search
MTKSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQKA
EEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLG
EYSGWYSVSDEEFFTESQLAEVYRDENGKVIGGIAPSGHEVEWVSEESYFLRLSKYQDRL
VEFFKSQPDFITPDGRLNEMLKNFIEPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDAL
LNYVTALGYGQDEHGNFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDIKLPDRLIAHG
WFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVARINYEL
ANDLGNLLNRTVAMINKYFGGQVPAYVENATAFDADLAKVVEESIAEYHKQMNAVDYPRA
LEAVWNIISRTNKYIDETAPWVLAKEDGDKEQLAAVMAHLAASLRVVAHLIQPFMMNTSN
AIMEQLGLGLDFDLENLTLAGFPENVTVVAKGTPIFPRLDMDEEIAYIQSQMTAGKTEEK
EWIPEEVEPKSEKDEIKFEDFDKVEIRVAEVKEVERVEGSDKLLRFRLDAGDGEDRQILS
GIAKFYPNEQELVGKKLQIVANLKPRKMMKKYVSQGMILSAEHGDQLTVLTVDSSIPNGS
IIG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatcattctacatcacaacccctatctattacccatctggtaaattgcatatt
ggttcagcttatacaaccattgcctgtgacgtcttggcgcgttacaaacgcatgatgaac
tacgatgttttctacctgactggtctcgatgagcacgggcaaaagatccagcaaaaagca
gaggaagctgggattacgccacaagcttatgtagatgggatggcggttggagtgaaagaa
ctctggcagttactcgatatctcatacgataaattcatccgtacgacagacgattaccat
gaaaaagtggtggcccaagtcttcgaacgcttactggctcaagatgacatctacctgggt
gaatactctggttggtattcagtctctgatgaagagttctttacagaaagccaattggct
gaggtttatcgagatgagaatggtaaagtcatcggtgggatagcgccatcaggtcacgaa
gtagaatgggtttctgaagaatcttatttccttcgcctcagcaaataccaagaccgcttg
gtcgaatttttcaagtcccaaccggatttcatcacgccggatggccgtctcaatgaaatg
ttgaaaaacttcatcgaacccggtttggaagacttggcggtatctcggaccacctttacc
tggggagtcccagtcccatccgatccaaaacacgtagtttatgtatggattgacgccctt
ctcaactacgtgacggcacttggttatggccaagatgagcatggcaactttgacaaattc
tggaacggaacggtcttccacatggttggaaaagatattcttcgtttccactctatctac
tggccaatccttctcatgatgctcgatatcaaattgccagatcgcttgattgcccatggt
tggtttgtcatgaaagacggcaagatgtctaagtctaaaggaaatgtcatctacccagaa
atgttggtagaacgctttggcttggatccgcttcgctactacctcatgcgcagtctgcca
gttggttcagatggtactttcacaccagaagactacgtggctcgtatcaactatgaattg
gccaatgaccttggaaacctcctcaaccggacggtggccatgatcaataaatactttggt
ggtcaagtccctgcttatgtcgaaaatgccactgcatttgatgcagatttggccaaggtg
gtcgaagaaagtattgcagagtaccataaacaaatgaatgcagttgattacccacgcgct
ttggaagcagtatggaacatcatctctcgtaccaacaagtacatcgatgagacagctcca
tgggtacttgctaaagaagatggtgacaaggaacaattggcagcggtcatggctcacttg
gcagcaagtctccgtgtcgtagctcacctcatccaaccattcatgatgaacacctcaaat
gccattatggaacaacttggcttgggcttggacttcgatcttgagaacttgaccctagca
ggcttccctgaaaatgtcacagtagttgccaaaggaactccaatcttccctcgcctggat
atggatgaagaaattgcctacatccaatctcaaatgactgctggtaaaacagaagaaaaa
gaatggattccagaagaagtggaacccaagtctgaaaaagatgagattaaatttgaagac
tttgacaaggtcgaaatccgtgtagcagaggtcaaagaagttgaacgcgtcgaaggatct
gacaaattgcttcgcttccgcctagatgcaggagatggcgaagaccgtcaaatcctctct
ggtatcgcaaaattctatccaaatgaacaagaattggtcggcaagaaactccaaatcgtg
gccaacctcaaaccacgtaagatgatgaagaaatatgtcagccaaggcatgattctttct
gcagaacatggggatcaattaacggtcttgaccgttgattcatctattccaaatggaagc
atcattggctaa

DBGET integrated database retrieval system