KEGG   Streptococcus sp. I-P16: N597_07180Help
Entry
N597_07180        CDS       T02880                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N597_07180
Enzymes [BR:sip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     N597_07180
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     N597_07180
    1.1.1.-  
     N597_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGY38742
UniProt: U5P9B5
Position
complement(1425402..1426442)
Genome map
AA seq 346 aa AA seqDB search
METMKAARWHGKKDVRIEEVEVPEVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFAGEIVEVGSNVTRVKVGDRVTIEPILAKHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVIFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGESIVEAIHRLTDGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEGFVELTQDKAQIKILVEP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaatgaaagctgcccgctggcatggcaaaaaggacgttcgtatcgaggaagtg
gaagtcccagaagtacaacctcatcaagtaaaggttgcggtcaaattcacgggaatctgt
ggaacagacttgcatgaatacttggatgggccaatcttcattccaacagaagagcatgtt
tattctggtcaaaaagcacccgtgaccctcggtcatgagtttgctggagaaattgttgag
gttggaagcaatgtgactcgtgtcaaagtcggggatcgtgtaacaatcgaaccaattttg
gcaaaacacaacttaattggtgattataacctcgatccaaacttgaattttgttggcctt
gctgcagatggaggttttgctaaatattgtgtcctagatggagatttggtccatgtgatt
ccagatagcttgagctatgaacaagctgctcttacagaacctgctgctgttgccgtttat
gcagttcgtcagtctgctttgaaaactggggatacagctgttatctttggtttgggccca
atcggtcttttgatcgtggaagctctccgtgcagctggggcatcgaaaatttatgcagtt
gaattgtctcctgaacgccaagctaaggctgaagaattgggtgccattgtggttcgccca
gaagaaggtgaatcaatcgttgaagccattcatcgtttgacggatggtggagcggatgtt
tcttatgaagtgacaggggttcctgttgttcttggacaagctttggcagctgtgcataag
gctggtgagtgtatggttgtttctatttgggaacgtgaagccagcatcaatccaaatgaa
ttcgccattcaagaaaagaccctcaaagggattatcgcttatcgtcacatcttccctaaa
gtattggaattgatggaacaaggctacttctctgctgaaaaattggtgaccaagaaaatt
aaattggaaaatatcgttgaagaaggatttgttgaattaacacaagataaggcccaaatt
aagattttggttgagccatga

DBGET integrated database retrieval system