KEGG   Streptococcus sp. I-P16: N597_07210Help
Entry
N597_07210        CDS       T02880                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00220  Arginine biosynthesis
sip00250  Alanine, aspartate and glutamate metabolism
sip00290  Valine, leucine and isoleucine biosynthesis
sip01100  Metabolic pathways
sip01110  Biosynthesis of secondary metabolites
sip01130  Biosynthesis of antibiotics
sip01210  2-Oxocarboxylic acid metabolism
sip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sip00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N597_07210
   00290 Valine, leucine and isoleucine biosynthesis
    N597_07210
   00220 Arginine biosynthesis
    N597_07210
Enzymes [BR:sip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     N597_07210
    2.6.1.66  valine---pyruvate transaminase
     N597_07210
Amino acid related enzymes [BR:sip01007]
 Aminotransferase (transaminase)
  Class I
   N597_07210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGY38748
UniProt: U5P4Z9
Position
complement(1431527..1432741)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSVKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYSQLKKIPNVEIDDIYIGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYVCDEEAEWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPDEILLEIVEIARQHGLIIFADEIYDRLVMDGAKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDREMYRVDDDEQFVLNFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVEELAQIQEKMTRFLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatacaataagtccgtcaagctagagcacgttgcttacgatattcgtggtcca
gtattagaagaagcgatgcgcatgcgggcaaacggggagaaaatccttcgcttaaataca
ggaaatccggctgaatttgggttcacggctcccgacgaagtcattcatgatttgattatg
aatgctcgggatagtgaagggtattcggattcaaaaggaattttttctgcccgtaaggcc
attatgcagtatagccaattgaaaaagatcccgaatgttgagattgatgatatctatatc
ggaaatggtgtcagtgagttgatcgtgatgtccatgcaaggcttgctggataatggcgat
gaagtacttgtgccaatgccagactatcctctttggacagcagcggtcagcctagcaggt
ggaaatgcagtacactatgtctgtgatgaagaggctgagtggtatcctgatattgatgat
atcaagtcgaaaatcacttcaaacaccaaggctatcgtcgtgattaacccaaataacccg
accggagctctctatccagatgagattttgttggaaattgtcgaaattgctcgtcaacat
ggcttgattatctttgcagatgaaatttatgatcgcttggtcatggatggtgccaaacac
acagccattgctagtctcgcgccagatttgttctgtgtcagcatgaacggtttgtccaaa
tcacaccgcatcgcgggcttccgtgtgggctggatggtcttgtctggaccaaaacaccat
gtgaagggctatatcgaagggctcaatatgctctccaatatgcgtctgtgttcaaacgtc
ttggcccaacaagtggttcagacttctttgggaggctaccagtcagtggacgaactcttg
ctcccaggtggtcgaatctacgagcaacggaactttatctacaaggccatcaacgatatc
ccagggctttcagctgtcaaaccaaaagctggtctttatatcttccctaagattgatcgt
gaaatgtaccgagtagatgatgatgagcagtttgtcttgaatttcttaaaacaagaaaag
gttctcttggttcacggacgtggattcaactggaaagagccggatcatttccggattgtt
taccttcctcgagtagaagaattggctcaaattcaagagaagatgactcgtttcttaaaa
caatacaaacgataa

DBGET integrated database retrieval system