KEGG   Streptococcus sp. I-P16: N597_07735Help
Entry
N597_07735        CDS       T02880                                 

Definition
(GenBank) cysteinyl-tRNA synthease
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sip00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N597_07735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sip01007]
    N597_07735
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sip03016]
    N597_07735
Enzymes [BR:sip01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     N597_07735
Amino acid related enzymes [BR:sip01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   N597_07735
Transfer RNA biogenesis [BR:sip03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    N597_07735
 Prokaryotic Type
    N597_07735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: AGY38850
UniProt: U5P5T5
Position
complement(1546962..1548305)
Genome map
AA seq 447 aa AA seqDB search
MIKIYDTMTRSLREFVPIEEGKVRMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYE
VAYISNFTDVDDKIINRAKEEGITPQEVADKYIAAFREDVTALGVKPATRHPRVVEFMDD
IIRFVTDLIEKGYAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENP
VDFALWKAAKPGEVSWESPWGPGRPGWHIECSVMSTGILGDTIDIHGGGADLEFPHHTNE
IAQSEAKTGKTFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTIDGQVLRFFFATQHY
RKPINFTEKAVRDAETNLKYLKNTYEQPFTGEVDPADLQSFVDKFVAAMDEDINAANGIT
VVFELAKWINSGHYNQDVKEALAKMLEVFGVVFVEEVLDADIEALIAERQEARAKKDFAR
ADEIRDELAAQGIKLLDTKEGVRWTRD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatttacgacaccatgacccgcagcttgcgagaatttgtccccatcgaggaa
ggaaaggtccgcatgtatgtttgtgggccaacggtttacaactatatccacgtggggaat
gcccgttcaacggtagcctttgacaccattcgtcgctactttgagtatcgtggctacgaa
gttgcctacatttccaactttaccgatgtggatgataagattatcaaccgcgccaaagaa
gaaggcatcacgcctcaggaagtggcagacaagtacattgcggcttttcgtgaggatgtg
acggctctgggggtcaagcctgctacccgtcaccctcgtgtggttgagtttatggatgat
attattcgttttgtcaccgacttgatcgaaaaaggctatgcctacgagagtcaaggggat
gtttatttccgtgtggaaaaatcccacaactacgccaaattggcgaataaaactctagaa
gacttggagctaggtgcttcaggtcggacagacgaagagacggctcgcaaggaaaatcct
gtcgactttgccctttggaaagctgccaagccaggtgaagtttcttgggaaagcccttgg
gggcctggtcgtccgggatggcacatcgaatgttcggtcatgtcaacggggattttagga
gataccattgatattcatgggggtggagccgatctcgaattcccgcaccataccaatgaa
atcgctcagtcagaggctaaaacaggcaagacctttgccaattactggatgcacaatggc
tttgtcaatattgacaatgtcaagatgtccaagtccttaggcaactttatcactgtgcat
gatgctctcaagactatcgatggccaagtgcttcgcttcttctttgcgacccagcactac
cgcaaacccatcaacttcacagaaaaagctgtgcgcgatgcggagaccaacctcaagtat
ttgaaaaatacctacgagcaacctttcacaggagaagtggatccagcagacttgcaaagc
tttgtggacaagtttgtagcggctatggatgaagatatcaatgcggcaaacggaatcacc
gtcgtctttgaattggccaaatggatcaactcaggacattacaaccaagatgtcaaggag
gccttggcaaagatgttagaagtctttggagtggtctttgtcgaagaagtcttggatgcg
gatattgaagccttgatcgctgaacgccaagaagcgcgggctaagaaagattttgcgcga
gcagatgaaattcgcgatgaattggctgcgcaaggaatcaagctcttggatacaaaagaa
ggtgtaaggtggacacgtgattga

DBGET integrated database retrieval system