KEGG   Sulfolobus islandicus REY15A: SiRe_0277Help
Entry
SiRe_0277         CDS       T01953                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00020  Citrate cycle (TCA cycle)
sir00640  Propanoate metabolism
sir00660  C5-Branched dibasic acid metabolism
sir00720  Carbon fixation pathways in prokaryotes
sir01100  Metabolic pathways
sir01110  Biosynthesis of secondary metabolites
sir01120  Microbial metabolism in diverse environments
sir01130  Biosynthesis of antibiotics
sir01200  Carbon metabolism
Module
sir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SiRe_0277
   00640 Propanoate metabolism
    SiRe_0277
   00660 C5-Branched dibasic acid metabolism
    SiRe_0277
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiRe_0277
Enzymes [BR:sir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SiRe_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADX84372
UniProt: F0NDN9
Position
complement(243208..244221)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGARGKRGLVRVTEDVYN
TILELKKLGVEKFLVEEFVPHEKEFYASVLLDRETGEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELVEINPLALTNDGRILALD
SKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITRCDEVALGIIDALKEVKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacgaatatgagggaaagagtctttttaagcgtgtagggataccagtgcct
aatggtgttgtaacttctgaaccaataagatggcaaggaaaagctgtagtaaaatctcaa
ctattggaaggcgctagaggtaaaagaggattagtaagagtaactgaagacgtttataat
actattttagagctgaaaaaactaggagttgagaaattcttagtagaggagtttgttcct
cacgagaaggagttttacgcttcagtattgttagatagggaaactggggaaccaatgtta
gttttatcaagagaaggaggcattgatgttgaacaagctaaggacgttaagaagatgata
ataccactagagaggggagttaggagttatgatattgttgaggctgagaagtatctagga
gttaagggattaggacaaataatacaaggtttatataaattatttgtagattacgacgct
gaactagttgagataaacccattagcattgactaatgatggtagaatattagctttagac
tctaaagtgattttagaggataacgcgttatatagacatgaggatttgttaaaggagtta
gggaggcaagaagttcgtgatagttatgtggaactagagggagatataggaataataggc
aatggtgcaggattaaccatggcttcaatggatctagttaaattaaatggtggaaatcca
gcaaatttcttggatgttggtggaggagctaatagggaacatgttaaagaaagtgttctc
aaagtgggtagtaatcctagagtcaaaaagattgttataaatatttacggtggaattact
agatgtgatgaggtagcgttaggtataattgatgcgctaaaggaggtaaagaagccaata
tttgttagattattaggaactaacgaggaattagggaagaaaatattaagagagaacggt
gtaaacgtatatgatgatgtgttaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system