KEGG   Sulfolobus islandicus REY15A: SiRe_1189Help
Entry
SiRe_1189         CDS       T01953                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sir01100  Metabolic pathways
sir01110  Biosynthesis of secondary metabolites
sir01130  Biosynthesis of antibiotics
sir01230  Biosynthesis of amino acids
Module
sir_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SiRe_1189
Enzymes [BR:sir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SiRe_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth TMP-TENI ThiG NanE YAF2_RYBP
Motif
Other DBs
NCBI-ProteinID: ADX85256
UniProt: F0NEX6
Position
complement(1140413..1141159)
Genome map
AA seq 248 aa AA seqDB search
MPRYLKGWLKDVVQLSLRRPSFRTSRQRPIISLNKRILEFNVRNVTAIIAEYKRKSPSGL
DVERDPIEYAKFMEKYAVGLSVLTEEKYFNGSYEILRKIASSVSIPILMKDFIVKESQID
DAYNLGADTVLLIVKILTERELESLMEYARSYGMEPLVEINDEKDLEIALRIGAKFIGVN
SRDLETLEINKENQRKLLSMIPSDVIKVAESGISERNEIEELRKLGVNAFLIGSSLMQNP
EKIKEFIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttatcttaaaggatggcttaaagacgtcgtacaattatctttaagaaggccc
tcgtttaggacttcaagacaaagaccgattatttccttaaataaaagaattttggaattt
aatgtgcgcaatgtcacagctataatagctgaatataagcgcaaatctccctctggattg
gatgttgaaagagatccgatagaatatgcaaagttcatggaaaagtatgcagtaggtctt
agcgtgctaactgaggaaaagtactttaatggttcatatgaaattttgagaaagatagcc
agttcagtttcaatccccatattaatgaaggattttattgtcaaggaatcacaaattgat
gatgcgtataacttaggtgcagatactgtattgctaatagtcaaaatacttactgaaaga
gaattagagagtttaatggaatatgccagaagttatggtatggaaccattggtagagatt
aatgacgagaaggatttagaaatagcactaaggataggggccaagtttataggagttaat
tcaagagatctagaaacccttgagataaataaggagaatcagagaaagcttctatcaatg
ataccatcagatgtaataaaggttgcagaaagtggaatttctgagaggaatgaaatagag
gaattgagaaaattaggtgttaatgctttcctaattggatcctcactaatgcaaaaccca
gaaaagattaaagaatttatactataa

DBGET integrated database retrieval system