KEGG   Sulfolobus islandicus REY15A: SiRe_1742Help
Entry
SiRe_1742         CDS       T01953                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00760  Nicotinate and nicotinamide metabolism
sir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SiRe_1742
Enzymes [BR:sir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     SiRe_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ADX85806
UniProt: F0NBP4
Position
complement(1610678..1611106)
Genome map
AA seq 142 aa AA seqDB search
MIILVGSSQESHTVTNPFTAGERVEMIRNSLKYSGIDLSRIFIIPMPDILMNNIWAHYVS
TYTPKFEVVFARNPLVVRIFKEAGYKVEIPPAFNREKYNSTYIRRLIILNDNWSELVPEP
VYKYILHIHGDQRLREIVGTDK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
ttgataattttagtaggtagttcacaagaaagccacactgtaaccaatccctttaccgca
ggagagagagtagaaatgataagaaattctcttaagtatagcgggatagatttgtctaga
atatttataataccgatgccagatattttaatgaacaacatttgggcacattatgtgagc
acttatacccctaaatttgaagttgtattcgccagaaatccattagtagttagaatattc
aaggaagccggatataaagtagagattcctccagcttttaatagagaaaaatataactca
acttatattagacgtcttataatcctaaacgataattggagtgaactagttccagaacct
gtatataagtacatcctacatatccatggagatcaaagattaagagagatagtaggtaca
gataagtaa

DBGET integrated database retrieval system