KEGG   Sulfolobus islandicus REY15A: SiRe_2042Help
Entry
SiRe_2042         CDS       T01953                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K18978  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+] [EC:1.2.1.90]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00010  Glycolysis / Gluconeogenesis
sir00030  Pentose phosphate pathway
sir01100  Metabolic pathways
sir01120  Microbial metabolism in diverse environments
sir01200  Carbon metabolism
Module
sir_M00633  Semi-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:sir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_2042
   00030 Pentose phosphate pathway
    SiRe_2042
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.90  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+]
     SiRe_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADX86100
UniProt: F0NCF3
Position
1887823..1889352
Genome map
AA seq 509 aa AA seqDB search
MEKTSLLIKSKELTGIYELKDGISYFKAYFAGQWISGDEWQDVISPIDLNVIAKIPKLSW
NQVDNTLEHIYRKGRWTIRDTPGEKRLDIYKKMASLLDKFKEDFVNVLMINNGKTRTAAE
GEVKAAIERLLRADLDVKETRGDYVPGDWSSETLETEAVVRKEPVGVVLSIVPFNYPLFD
TVNKIVYTTVIGNAIIIKPPSSTPLPILMLAKVMELASFPKDSFAIITLPGREMTKVVGD
KRIQAISLTGSTETGEEVVRNAGIKQFIMELGGGDPAIVLSDADLAWAAQRIATGIISYT
GQRCDSVKLVLVEEEVYDTLKDLLVKELTKSVKVGDPRDPSTTVGPVIDVKTVDEWEKAI
KDAVEKGGKILFGGKRLGPTYIEPVLIEAPKETLKDMYFYNKEVFASAALLIKVKNIDEA
LEISNSRKYGLDAAIFGKDINKIRKLQRFLEVGAVYINDYPRHGIGYFPFGGRKDSGIGR
EGIGYTIQYVTAYKSIVYNYKGKGIWEYL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacttcattgttgataaaatctaaggagcttacgggaatctatgaactaaaa
gatggaatatcttactttaaggcttatttcgcaggccagtggattagtggagatgagtgg
caagatgtgattagtccaattgacttaaacgttatagcaaaaattcctaaattaagctgg
aatcaagtagataataccctagagcacatatatagaaagggaagatggactatacgagat
acaccgggggaaaagagattagacatatataagaagatggcatctttgttggataaattt
aaggaagatttcgttaatgtgctaatgattaacaacggtaaaacaagaactgctgcagaa
ggtgaagtcaaagctgcaatagagaggttattacgcgcagatttagacgtcaaagaaaca
agaggagattatgtacctggcgattggagctcagagactttagagacagaagctgtagta
agaaaagaaccagtgggagttgttctttccattgtgccatttaattatcccctatttgat
actgtaaataaaatagtttacactactgtaattggaaatgcaataattattaaaccacca
tcttcaactccattacccatcttaatgctagctaaggttatggaattagcgagttttccg
aaggattcgtttgccataattactctacccggcagagagatgactaaggtagttggagac
aaaaggattcaagcgatatcattaactggaagtactgaaactggagaagaggtagtaaga
aacgctggaattaaacaattcataatggaactaggaggaggagatccagcaatagttttg
agtgatgcggatttggcatgggctgcgcaaagaatagcaactggaataataagctatact
ggacaaagatgtgattcagtaaagttagttctggttgaagaagaagtgtatgatacactg
aaagacttgcttgtaaaagagttgacaaaatcagttaaggttggagatcctagggatcca
tcaacgaccgttggacccgttatagacgtaaaaacagtagatgaatgggaaaaggctata
aaagatgctgttgaaaaaggtgggaaaatactatttggaggtaagagattaggtcctacg
tatattgaaccagtattaatagaggcgccaaaagagacccttaaagacatgtacttctat
aataaggaagtatttgcgtctgcagcgcttttaattaaagttaaaaacattgatgaggct
ttagaaatttccaatagtagaaaatatggattggatgcagcaatatttggaaaagacata
aacaagattaggaagcttcaaaggttcttagaagtaggtgctgtttatataaacgactat
cccagacatggaattggctacttcccatttggcggaaggaaggattctggaattggtaga
gagggtattgggtacacaattcaatatgtaacagcctacaaatcaatagtctataattat
aaagggaaaggtatttgggaatacttgtaa

DBGET integrated database retrieval system