KEGG   Sulfolobus islandicus REY15A: SiRe_2382Help
Entry
SiRe_2382         CDS       T01953                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00010  Glycolysis / Gluconeogenesis
sir00020  Citrate cycle (TCA cycle)
sir00620  Pyruvate metabolism
sir00640  Propanoate metabolism
sir00650  Butanoate metabolism
sir00680  Methane metabolism
sir00720  Carbon fixation pathways in prokaryotes
sir01100  Metabolic pathways
sir01120  Microbial metabolism in diverse environments
sir01130  Biosynthesis of antibiotics
sir01200  Carbon metabolism
Module
sir_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_2382
   00020 Citrate cycle (TCA cycle)
    SiRe_2382
   00620 Pyruvate metabolism
    SiRe_2382
   00640 Propanoate metabolism
    SiRe_2382
   00650 Butanoate metabolism
    SiRe_2382
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiRe_2382
   00680 Methane metabolism
    SiRe_2382
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiRe_2382
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiRe_2382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADX86431
UniProt: F0NFP5
Position
complement(2220775..2221329)
Genome map
AA seq 184 aa AA seqDB search
MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISENPIRV
TSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDLNWRTFHVNATKIATDL
GLVKSGWPMVNVIILGALIRVMGIPKLSSLEQAIEEEFGGKIAELNIKGARLAYEQVGVE
YVTA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgaaataagattccacggtagaggtggacaaggtgttgtaacggcttctcaacta
ttagctgaagcagctggatatgaaaacctttacacttcttcttttcccatttatggagcg
gaaaggagaggtgcagaaatagaggcatattgtagaatatccgagaacccgattagggtt
acttccccagtagaagaaccagattacttggtcgtaatagataattcccttctccaaata
tctaggaatttgttcagaggactaaaagatacttcgacgataatattaaattcaccttcc
aaaccggatcttaactggagaacttttcacgttaatgcaactaaaattgcaacagatcta
ggcctagtaaagtcagggtggccgatggtgaacgtaatcatcttaggagcgttaataagg
gtaatgggaatacctaaattatcttcacttgagcaagcaatagaagaggaatttggaggc
aaaatagctgaactcaacataaaaggtgcaagattggcctatgaacaagttggtgttgag
tatgtcactgcttga

DBGET integrated database retrieval system