KEGG   Sulfolobus islandicus L.S.2.15: LS215_0109Help
Entry
LS215_0109        CDS       T00889                                 

Definition
(GenBank) precorrin-2 C20-methyltransferase
  KO
K03394  precorrin-2/cobalt-factor-2 C20-methyltransferase [EC:2.1.1.130 2.1.1.151]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00860  Porphyrin and chlorophyll metabolism
sis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LS215_0109
Enzymes [BR:sis01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.130  precorrin-2 C20-methyltransferase
     LS215_0109
    2.1.1.151  cobalt-factor II C20-methyltransferase
     LS215_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Mut7-C
Motif
Other DBs
NCBI-ProteinID: ACP34262
UniProt: C3MJI4
Position
complement(95878..96546)
Genome map
AA seq 222 aa AA seqDB search
MKLYVVGLGPGDEELITIRGAKILKEVRTIFIPYSTGTNRSLAENIVKKYAKSNSKLVLL
GFPMAKDVNENELKKIGEKICNESEGDSAFVTLGDPTLYSTFFRIKDKLPCNVNVEIIPG
VSSVTACASKAMISLANSEDSISIIPASRLDSIEKASEIFETIIVLKANENIKEIAQMLS
NKYDLLYARRCFMNDEKLVNMEKEIVNDKDYFSMIIALRKKR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgtggttggattaggaccaggtgatgaggagttaataactataagagga
gcgaaaatccttaaggaggttagaactatcttcattccctattccactggaaccaataga
agtctggcagagaacatagtcaagaaatatgctaaaagtaattcaaagctggttctatta
ggttttcccatggcaaaggacgttaatgagaatgagttgaaaaagataggagaaaagatc
tgtaatgaaagtgaaggcgactccgcatttgtaaccttaggtgatccaacgttatatagc
acattcttcagaataaaggataaattaccatgtaatgttaacgtggaaattatccccggc
gtctcttccgtaaccgcttgtgcctcaaaagctatgatatctttagcgaattctgaggat
tcgataagtataataccagcttcaagactagactctattgaaaaagctagcgaaatattc
gagactataatagtacttaaggctaacgagaacattaaggaaatagctcaaatgctttcc
aacaaatacgacttactttatgctagaagatgtttcatgaacgacgaaaagttagttaat
atggaaaaagagatcgttaatgataaggattacttctcaatgataatagctttgagaaag
aaaaggtga

DBGET integrated database retrieval system