KEGG   Sulfolobus islandicus L.S.2.15: LS215_0395Help
Entry
LS215_0395        CDS       T00889                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00010  Glycolysis / Gluconeogenesis
sis00020  Citrate cycle (TCA cycle)
sis00620  Pyruvate metabolism
sis00640  Propanoate metabolism
sis00650  Butanoate metabolism
sis00680  Methane metabolism
sis00720  Carbon fixation pathways in prokaryotes
sis01100  Metabolic pathways
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01200  Carbon metabolism
Module
sis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0395
   00020 Citrate cycle (TCA cycle)
    LS215_0395
   00620 Pyruvate metabolism
    LS215_0395
   00640 Propanoate metabolism
    LS215_0395
   00650 Butanoate metabolism
    LS215_0395
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_0395
   00680 Methane metabolism
    LS215_0395
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LS215_0395
Enzymes [BR:sis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LS215_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACP34536
UniProt: C3ML11
Position
complement(335666..336559)
Genome map
AA seq 297 aa AA seqDB search
MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVPASCTTIIMGDTSGMP
STVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTGDIGFASLSGAAERNED
ILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLPFIIAEHKVPYVATASIA
YIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTAKLAVETGVWPLFEIENGE
FRLTSVSKTLLDKKNRKPVAEYLKLQGRFKQLTEEEIKGIQEEIDEMWEEIKKLVKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagtttagttacacctaagaggatacccaagttctatagaggtaatgctgcttgt
ccgggttgcccaatacctaaagagttagatgtactcctagaggttttaggaaataaaacc
gttctagtcgttccagcctcatgtaccacaataataatgggagatacaagtggaatgcct
tcaactgtcccagtgatacatagtgcatttggtgctcccgcagctatagcttccggcatt
gttagagctttaaggactaggggagataaggatgtaatagtaaccgtatgggctggtgat
ggttctactggagatataggatttgcatcattaagcggtgctgcagagagaaatgaggat
atcctttacgtatgttatgataacgaagcgtatatgaatactggaattcaacgttcaagc
ttgacgccaaaaggtgcatggacaacgacaactccagaaggtaagagggaatataagaaa
cccttaccattcataattgcagaacataaagtaccatatgtagctactgcttcaattgct
tacatatacgattatgaagccaaggtgaggaaagctaagcaaattcgtggatttagatat
ttacacttattatccccatgtccgcccggatggcgtttcgactctaaattgactattgac
actgcgaaacttgcagttgagactggagtttggccactctttgaaatagaaaatggtgag
tttagattgactagtgtaagtaagacactacttgacaagaagaataggaaaccagtagcg
gagtatttaaaattgcaaggaagatttaaacagctcactgaagaggaaataaagggtata
caagaggaaatcgatgagatgtgggaggaaattaaaaaactagttaagaagtaa

DBGET integrated database retrieval system