KEGG   Sulfolobus islandicus L.S.2.15: LS215_0396Help
Entry
LS215_0396        CDS       T00889                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00010  Glycolysis / Gluconeogenesis
sis00020  Citrate cycle (TCA cycle)
sis00620  Pyruvate metabolism
sis00640  Propanoate metabolism
sis00650  Butanoate metabolism
sis00680  Methane metabolism
sis00720  Carbon fixation pathways in prokaryotes
sis01100  Metabolic pathways
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01200  Carbon metabolism
Module
sis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0396
   00020 Citrate cycle (TCA cycle)
    LS215_0396
   00620 Pyruvate metabolism
    LS215_0396
   00640 Propanoate metabolism
    LS215_0396
   00650 Butanoate metabolism
    LS215_0396
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_0396
   00680 Methane metabolism
    LS215_0396
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LS215_0396
Enzymes [BR:sis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LS215_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACP34537
UniProt: C3ML12
Position
complement(336556..337713)
Genome map
AA seq 385 aa AA seqDB search
MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKISEYIASEELNAELIKV
ESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRVPMVAAVATRAIAEPWS
IWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERVILPVMMGFDGFILTHTM
ERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIKYRYEAMKAMERAKGVIEE
VMNEYERISGRKQNGLVECYKCEDAKYVFVTMGAWSGDCKVAVDRLRDAGVEAGLLKIRV
FRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKATLYGYRVPVYSVIAGIGGKD
VRPRHFQKVIEDLINDNLEEERWLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttaaagaggaaaactttagctttagttggtaatcacgcagttgcttatgct
gttaagcaatctaaacctcaagttttagcggtgttcccaataactcctcaaactacaatg
ctagagaaaatttccgaatacatagcttctgaggaattaaatgctgagttaataaaggtg
gaaagtgagcattctgcgttggcttcaatttatggtgctgcattggctggtgctagagtt
ttcactgcaacgtcttctcaaggactactatacatgactgagatgatatattgggctgga
ggtcaaagagtccctatggttgctgcagttgcaactagggcaattgcagagccttggagt
atttgggatgatcatcaagatttcctaagtaagagagatgcaatttggattcaaatgatg
gcagaaaacgttcaagaggcttacgatatgacaatacaagcgtttagaatttcagaagat
gagagagtaatcttaccagtcatgatgggatttgatggcttcatattaactcacacaatg
gaaaggattgaggtattagaggatggtgaggttgacaactttttaccgcctagacaattt
aacctaattgacttctctgatcctattggtgttggaccaatcgcaactccagaggattac
atcaagtataggtatgaggctatgaaggccatggaaagagctaaaggggttattgaggaa
gtaatgaatgaatacgagaggataagtggaaggaaacaaaacggtttagttgagtgttat
aaatgtgaagatgccaaatacgttttcgttaccatgggagcgtggagtggtgactgtaag
gttgctgtggatagactaagggatgctggggttgaggctggattgctcaaaatcagggta
tttagaccattcccaaaggagaaaatagaggaatacttaaggtcaatgaaaggtgtaata
gttctcgatagagcttattcgtatggttctggggggattttagcaaatgagataaaagct
acactttatggctatagagtaccagtttacagcgtaatagcaggtattggtggaaaggac
gttaggccacgtcacttccaaaaggtgattgaagacctaatcaacgataatttggaagag
gagaggtggttgttgtga

DBGET integrated database retrieval system