KEGG   Sulfolobus islandicus L.S.2.15: LS215_1004Help
Entry
LS215_1004        CDS       T00889                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00630  Glyoxylate and dicarboxylate metabolism
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01200  Carbon metabolism
Module
sis_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LS215_1004
Enzymes [BR:sis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     LS215_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACP35039
UniProt: C3MNS6
Position
907517..908830
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWSEEEKRLEYEWSEDPRWKGIKRNYKPSDVVKLRGSIRIEYSIAKLASHKLWNL
LNTEPYIATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALLRADQISWSEGKHDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIRGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKLLAYNLSPSFNWKKFMDDSKISRFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQESEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggagtgaagaggaaaaaagacttgaatacgagtggtccgaa
gatccaaggtggaaaggaataaagagaaattataagccctcggatgtggtaaaattaagg
ggatctatcagaattgagtatagtatagctaaattagcctctcataaactttggaacttg
ctaaatactgagccctatatagcaacatttggggcattaacgggttcccaagcagttgaa
atggcaaaagcgggccttaaagcaatttacgtaagtggatggcaagtagctgctgataac
aatttatcaaatcaaacttatccagacttgagcttatatccatctaacagtgttccaaac
ttagtaaagaggttaaataacgctcttttaagggctgaccaaatatcttggagtgagggt
aaacacgatatcgattacttactgcctattgttgcagatgctgaagctggtttcggtggt
ccaattcacgctttcgaactaacaaaagccttaatagaggcaggggctgcgggcgtacat
tttgaagatcaattagcagcggagaaaaaatgtggacatttaggaggaaaagttctaatt
ccaataagtgcatttataagagtactaaacgctgcaagactagcatctgacgtattagga
gtacccacaatactaatagcaaggacagacgcactaaatgcgaaatacttatctaacgat
gtagatgagactgataatcaattcttaactggaaaaagaacatcagagggatattatgag
attaggggaggtatcgaatacgctattgccagaggattagcttatgcaccctatgcggac
ctattatggtttgagacttctaagccagatttggaagaggctagacaatttgcagaggct
atccacactcattaccccggtaagttgttagcgtataacctatccccctcatttaactgg
aagaaatttatggatgattccaaaatcagtaggttcatgaacgaattaggagaaatgggc
tataaattccaattcataacccttgcaggttggcacttaattaactaccatacattcaaa
ttggcgagagcatatagaaacgaaggaatgccagcatatgtaagactacaggagtcagag
ttccaggctcaagcagaaggatatacggccgtaagtcatcagagagaggttggaacagat
tacttcgacctagtgttaacaatagcatcggggggagaagcgtccactactgcaatggaa
ggttctactgaagctgaacagtttgtagaggcaaaacagaaagtattgaaataa

DBGET integrated database retrieval system