KEGG   Sulfolobus islandicus L.S.2.15: LS215_1135Help
Entry
LS215_1135        CDS       T00889                                 

Definition
(GenBank) medium-chain-fatty-acid--CoA ligase (AlkK-1)
  KO
K18861  4-hydroxybutyrate---CoA ligase (AMP-forming) [EC:6.2.1.40]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00720  Carbon fixation pathways in prokaryotes
sis01120  Microbial metabolism in diverse environments
sis01200  Carbon metabolism
Module
sis_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_1135
Enzymes [BR:sis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.40  4-hydroxybutyrate---CoA ligase
     LS215_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding
Motif
Other DBs
NCBI-ProteinID: ACP35154
UniProt: C3MP41
Position
1057071..1058495
Genome map
AA seq 474 aa AA seqDB search
MSSVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIKW
AWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELANH
IRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPVVETAMWRCGATVIAGGGETYFSWKNRHNMIFKLWKVDVFATTPWLHRLVGEEAKIEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWED
MEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYGITH
MRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIETR
REQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttaaaaacgaatacgatgcaattcatagggaattacgagaacaaggtttt
attagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatgaca
atgaaaagagaggaaatcgataagttaaagacgtttagactaagaaggattataaagtgg
gcatgggaaaacattgagttctatagaaggttttggaaatctaaaaacttcgaaccagac
atgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaattagg
aaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaatcac
ataagatttgttggagcgacttctggctcaactggattacctaccttccaaggatggggg
gctttagaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgccgaa
gttaagccaactaaggtttacgcaaactacctaaacatgagtggcttttatagttggggg
cctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggtggt
gagacatacttctcatggaagaatagacacaacatgatcttcaaactatggaaagttgac
gtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgagggt
tgggaaactcccttcaaggttttgctacttcacggtggtgcagctgctgaaaacactaaa
aagaaattattcaaggttcatccaaatgctgaattagctataagtgtttggggaaccact
gatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggaggac
atggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaaaga
ggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagttta
ggagattacgttaagaatgacttcctgaccgatccggatcctaagtatggtataactcac
atgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaagggaaa
ctattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactggaatg
tttaacattttcatttacgataatagtatggataaattgaagattagaatagagacaagg
agggaacaggttaattctacttacgataagcaagccagagagatattagcgagcaggatt
gggattaacccagatgacgttgagatagagtgggtaaagcctggaaatacaatatggacg
ggctacaagttgcaagtgtttgttgaccagaggaagaagaaataa

DBGET integrated database retrieval system