KEGG   Sulfolobus islandicus L.S.2.15: LS215_1323Help
Entry
LS215_1323        CDS       T00889                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00500  Starch and sucrose metabolism
sis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LS215_1323
Enzymes [BR:sis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LS215_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ACP35331
UniProt: C3MPL8
Position
1244968..1246311
Genome map
AA seq 447 aa AA seqDB search
MKRIILGFEVHQPFRIRRDFFWNPRFRQSLEDRFFDTERNKDIFERIKKNCYIPATNIIL
NSIERAEEEGKDVKYFFSISGTFLEQAERWGREVIDLFQQLAYTHKVEFLAQTYYHSVTG
LWEDKSEWREQIKMHRDAIKSYFGQYPTTFENTELITKRDIIEEAERMGFKMMLSEGTSR
NLRGRSPNYVYKLKGHEIRILFRNYILSDDIAFRFSNPNWDQYPLTASKYADWISKSEGN
VGLIFVDYETFGEHHKEHTGILEFLKWLPIELENKGVEMMMPKDVYNDVYDEIEISHTTS
WADIEKDEKSWLGNIMQWAYDDAVRRAEMPSRELGNEYLRVWRYFTTSDNYYYLYLGHGS
PAEVHSYFNAFGSPIDAFINEFYAISTFIHEEINKLNIKNEPYIFMLGDKRASIAWNEKE
FMEIVMRDERFKTHLKNLRQWLGNEKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataatattaggatttgaagttcatcagccgttcaggattagaagagatttc
ttctggaacccgagatttaggcaaagcttagaggataggtttttcgatactgagagaaat
aaggatatatttgagagaataaagaagaactgctatatccctgcaactaatataatacta
aactccattgaaagagctgaagaggaaggtaaagacgttaaatacttcttttcaatttca
ggtactttcttagagcaagctgaaagatggggaagagaagtaatagacttgtttcaacaa
ttggcttacactcataaagttgaatttctagcacaaacatactatcactcagtaactggt
ctttgggaggataaaagtgaatggagagaacaaattaagatgcatagggatgctataaaa
tcgtattttgggcaatatcctactacttttgaaaacactgaattaataactaaaagggat
attatagaagaagctgaaaggatgggctttaagatgatgttaagcgaagggactagtagg
aatttaaggggaagaagtccaaattatgtctataaattaaagggacatgagattagaata
ttgtttagaaattacatattaagtgacgatatagccttcaggttttctaatccaaattgg
gatcaatatccgttaacggcttccaaatacgctgattggataagtaagagtgagggaaat
gtgggattaatattcgtagattacgagacttttggagaacatcacaaagagcatactgga
attttagaatttctcaaatggctaccaatagagcttgagaataaaggggtggaaatgatg
atgccaaaggacgtttacaatgatgtctatgatgaaatagagatctctcacactacctca
tgggcggatatagaaaaggatgagaaaagttggttaggtaatataatgcaatgggcttac
gacgacgcagttagaagggctgagatgccctcaagggaattggggaatgagtacttaaga
gtttggaggtatttcactacaagcgataattactattatctttatttagggcatgggagt
ccagctgaagtacattcctatttcaacgcctttggatctcctatagacgcatttataaat
gaattttatgcaatatcgacatttatacatgaggagataaataaattaaatattaagaat
gagccttatatatttatgttaggagataagagagcgtcaatagcttggaatgaaaaagaa
ttcatggaaattgtaatgagagatgaaaggtttaaaactcatttgaaaaacttaaggcag
tggttaggaaatgaaaaggattga

DBGET integrated database retrieval system