KEGG   Sulfolobus islandicus L.S.2.15: LS215_1413Help
Entry
LS215_1413        CDS       T00889                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01130  Biosynthesis of antibiotics
sis01230  Biosynthesis of amino acids
Module
sis_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LS215_1413
Enzymes [BR:sis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LS215_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth TMP-TENI ThiG NanE YAF2_RYBP
Motif
Other DBs
NCBI-ProteinID: ACP35421
UniProt: C3MPV8
Position
complement(1328650..1329396)
Genome map
AA seq 248 aa AA seqDB search
MPRYLKGWLKDVVQLSLRRPSFRTSRQRPIISLNKRILEFNVRNVTAIIAEYKRKSPSGL
DVERDPIEYAKFMEKYAVGLSVLTEEKYFNGSYEILRKIASSVSIPILMKDFIVKESQID
DAYNLGADTVLLIVKILTERELESLMEYTRSYGMEPLVEINDEKDLEIALRIGAKFIGVN
SRDLETLEINKENQRKLLSMIPSDVIKVAESGISERNEIEELRKLGVNAFLIGSSLMQNP
EKIKEFIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttatcttaaaggatggcttaaagacgtcgtacaattatctttaagaaggccc
tcgtttaggacttcaagacaaagaccgattatttccttaaataaaagaattttggaattt
aatgtgcgcaatgtcacagctataatagctgaatataagcgcaaatctccctctggattg
gatgttgaaagagatccgatagaatatgcaaagttcatggaaaagtatgcagtaggtctt
agcgtactaactgaggaaaagtactttaatggttcatatgaaattttgagaaagatagcc
agttcagtttcaatccccatattaatgaaggattttattgtcaaggaatcacaaattgat
gatgcgtataacttaggtgcagatactgtattgctaatagtcaaaatacttactgaaaga
gaattagagagtttaatggaatataccagaagttatggtatggaaccattggtagagatt
aatgacgagaaggatttagaaatagcactaaggataggggccaagtttataggagttaat
tcaagagatctagaaacccttgagataaataaggagaatcagagaaagcttctatcaatg
ataccatcagatgtaataaaggtggcagaaagtggaatttctgagaggaatgaaatagag
gaattgagaaaattaggtgttaatgctttcctaattggatcctcactaatgcaaaaccca
gaaaagattaaagaatttatactataa

DBGET integrated database retrieval system