KEGG   Sulfolobus islandicus L.S.2.15: LS215_1427Help
Entry
LS215_1427        CDS       T00889                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00260  Glycine, serine and threonine metabolism
sis00750  Vitamin B6 metabolism
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01230  Biosynthesis of amino acids
Module
sis_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LS215_1427
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LS215_1427
Enzymes [BR:sis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LS215_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 HypA Prok-RING_1 zinc_ribbon_2 Mu-like_Com TF_Zn_Ribbon zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ACP35435
UniProt: C3MPX2
Position
1341632..1342822
Genome map
AA seq 396 aa AA seqDB search
MKCLSCGYETEIDQDQILCPRCGGLLEIIVEPPKDFSFSKLRGRGVWRYKELIAGKYKNI
VSINEGNTPLIRSSNINDNLFFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIVPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIATAIVKGKDSPDFVENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAIAVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttaagttgtggatatgaaacggaaatagatcaagatcagatattatgtcca
agatgtggaggactattggaaattatagtggaaccaccaaaggacttctctttcagcaaa
ttgagaggaagaggagtttggagatacaaagaactgatagcaggcaaatataaaaatatt
gtaagtataaatgaaggaaataccccgctaataagatcctcaaatataaatgataatctt
ttttttaaattcgaaggacttaatcctactggaagttttaaggatagaggaatgacagta
gcagttagttctgcagtaagcttaaactacaaaaccgtaatagcagcatctactggaaac
actgcagcttccgcagctgcttatgctgcaagagcaggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcagtcaatactttatggctcagttatt
ttagaggttgatggaagttttgacgttgctatggatgcggtaatgaggttatataaggat
ttaaaagtagtatatccattaaattcttttaacccatggagattagaaggacagaagaca
atagcatttgagatagcggaagaactaggagttccagataatgtgatagtcccagtaggc
aatgcaggcaatatttacgcaatatggaagggatttaatgagctagttaaaactggagtg
ataaatactattcccagaatgattggaatccaagctgagggagcatcaccaatagctact
gcaatagtcaaaggcaaagattctccagatttcgtagaaaatccagatactgtagctact
gcaataagaataggaaaaccagtaaattggcaaaaagcgatgaaagcaataagagaatcc
aatggaaccgcaatagcagtatctgattctgaaatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttacattaag
gcaataaatgaaaaggtagtagataaagatgaaaaaacagttttaatcctaacaggacat
tcattaaaagatcccgatagtatgaccaaagctgaagctaagagaatattagttaatcct
ctacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system