KEGG   Ruegeria sp. TM1040: TM1040_0058Help
Entry
TM1040_0058       CDS       T00359                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00970  Aminoacyl-tRNA biosynthesis
sit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TM1040_0058
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sit03029]
    TM1040_0058
Enzymes [BR:sit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TM1040_0058
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TM1040_0058
Mitochondrial biogenesis [BR:sit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TM1040_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABF62791
RoseoBase: TM1040_0058
UniProt: Q1GKM5
Position
60494..61825
Genome map
AA seq 443 aa AA seqDB search
MQDWLTMSAAQLGRGIASGEIDPVALTEAYLTAIDSHPETARIYTKVTHERARAEAKAAQ
ERAKAGLRRSPLDGVPISWKDLFDSAGVETESGSDLLKGRIPDTDALVLDTATALGSVCL
GKTHMSELAFSGLGLNPIKATPPCVNDPEAVPGGSSSGAAASVAFGLAAGAIGSDTGGSV
RIPSAWNDLVGLKTTSGRVSLEGVVPLCLKFDTIGPLARSVEDAALMLALIEGSATAPDL
EGATVEGKRFADLRTVAQDDLAPEVATAHAAALDKLREEGAEIVPLEVPELPDAMALSAI
LFTTEAYGLWKDVIEASPDLMFPEILARFRSGAEFSGSDYVAAWAKLEQVRMAWDQAVAG
FDAVLAPAAPILPPNLARLQSDHDYYVTSNLMALRNTRIGNLMGVCALSLPTGTPSCGLQ
VIGQPDCEEALLRIGAGVEAALA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactggctgaccatgagcgcggcgcaattggggcgcgggatcgcctccggagag
atcgacccggtggcactgacagaggcctatttgacggcgatcgacagccatcctgagaca
gcgcggatctacacgaaagtcacccacgagcgcgcacgcgccgaggccaaggccgcgcaa
gagcgcgcaaaagccggcctgcgccgctcaccgctcgatggggtgccaatcagctggaag
gatctttttgacagtgccggggtagagaccgagtccggctcggatctcctcaaaggacgg
atccccgataccgacgcgctggtgctggacacagctacggcgctggggtcggtgtgcctt
ggcaaaacacatatgagcgagctggccttttctggtcttggcctcaatccgatcaaggca
accccgccttgtgtgaatgatcccgaggcggtgccgggcgggtcgtcctcgggcgcggca
gcctctgtggcttttgggctagcggcaggggcgatcggctctgataccggcggatcagtg
cgaatcccatcggcctggaatgatctcgtggggctcaagaccacctccgggcgggtgagc
cttgagggagttgtgcccctgtgtctgaagttcgacactatcggcccgctggcgcgcagc
gtcgaagatgcggccttgatgctggcgctcatcgaaggctctgccacggcgccagatctc
gagggcgcgacggtcgagggcaagcgctttgcggatctgcgcaccgtggcgcaggatgat
ctcgcacccgaagtggccacggctcatgcggccgcccttgataagctgcgcgaggaaggg
gcagagattgtcccgctcgaggtgccagagttgccagacgcgatggcgctctctgctatc
cttttcaccaccgaagcctacggcctgtggaaagacgtgatcgaggcctctcctgatctg
atgttccccgagatactcgcccgctttcgctctggtgcggagttttcgggctctgattat
gtggctgcctgggccaagcttgaacaggtgcggatggcctgggatcaggcggttgcgggc
tttgatgcggtgctggccccggcagcgccgatcctgccgcccaatcttgcacggcttcaa
agcgatcacgattactacgtcacctcgaacctgatggcgctcaggaatacgcggattggc
aacttgatgggcgtctgcgcgttatcgttgcccacaggcacgccaagctgtggtttgcag
gtgatcggccagcccgactgcgaagaggcgcttttgcgcatcggtgctggcgtcgaagcg
gcactggcctga

DBGET integrated database retrieval system