KEGG   Ruegeria sp. TM1040: TM1040_0067Help
Entry
TM1040_0067       CDS       T00359                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00071  Fatty acid degradation
sit00072  Synthesis and degradation of ketone bodies
sit00280  Valine, leucine and isoleucine degradation
sit00310  Lysine degradation
sit00362  Benzoate degradation
sit00380  Tryptophan metabolism
sit00620  Pyruvate metabolism
sit00630  Glyoxylate and dicarboxylate metabolism
sit00640  Propanoate metabolism
sit00650  Butanoate metabolism
sit00900  Terpenoid backbone biosynthesis
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
sit01212  Fatty acid metabolism
sit02020  Two-component system
Module
sit_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:sit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TM1040_0067
   00630 Glyoxylate and dicarboxylate metabolism
    TM1040_0067
   00640 Propanoate metabolism
    TM1040_0067
   00650 Butanoate metabolism
    TM1040_0067
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TM1040_0067
   00072 Synthesis and degradation of ketone bodies
    TM1040_0067
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TM1040_0067
   00310 Lysine degradation
    TM1040_0067
   00380 Tryptophan metabolism
    TM1040_0067
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TM1040_0067
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TM1040_0067
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TM1040_0067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sit04147]
    TM1040_0067
Enzymes [BR:sit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TM1040_0067
Exosome [BR:sit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TM1040_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABF62800
RoseoBase: TM1040_0067
UniProt: Q1GKL6
Position
70985..72157
Genome map
AA seq 390 aa AA seqDB search
MTKIVIAGAARTPMGGFQGMYDGVSAADLGGAAIKAALERAGATTVDEVLMGCVLPAGQG
QAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMVAYDQIALGHSDVMVAGGMESMTNAP
YLLPKMRGGARIGHGQVIDHMFLDGLEDAYDKGRLMGTFAEDCAEHYQFSREEQDAFALG
SLSNALAAQESGAFEGEITEVTVKTRKGAVVTDADEQPKSARPDKIPTLKPAFREGGTVT
AANSSSISDGAAALVLASETAAAARGLSVRGHILGHASHAQAPGWFTTAPVPAARKLMAQ
IGWDVEDVDLWEVNEAFAVVPMAFMREMGIPREKVNVNGGACALGHPIGASGARIMVTLL
NALEKRGLKRGIAAICIGGGEGTAIAIERA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatcgttatcgcgggtgcagcccgaacgccgatgggtggatttcagggcatg
tacgacggcgtcagcgcagcggatctcggtggcgcggccatcaaggcagcgttggaacgc
gccggtgcgacaaccgtggatgaggtcttgatgggatgcgttctgccagcaggtcagggt
caggcgccggcacggcaggccggatttgctgccggtcttggcgaggaggttcccgccacc
acgctcaacaagatgtgcggctctggcatgaaggcggcgatggtggcctatgatcagatt
gcgcttgggcacagcgatgtgatggttgcgggcggtatggagagcatgaccaatgccccc
taccttctgcccaagatgcgcggtggcgcccggatcggccacggtcaggtcattgatcat
atgttcctcgacgggcttgaggatgcctatgacaaggggcgcctgatgggcaccttcgcc
gaagactgcgcagagcattatcagttcagccgcgaggagcaggacgcctttgcgctgggg
tccttgtcaaacgctctggcggcgcaggaaagtggcgcgtttgaaggtgaaattactgaa
gttacagtgaaaacccgcaaaggcgctgttgtcacagatgcggatgagcagcccaaatcc
gcccgccccgacaagatcccgaccctgaagcccgcctttcgcgagggggggacggtcacc
gcagccaactcctcgtcgatctcggatggggcggcggcgctggtactggcctccgagacc
gccgctgcagcgcgcgggctttcggtgcgcggtcacatccttggccacgcgagccacgca
caggcaccgggctggttcaccaccgccccggttcctgccgcacgcaagctgatggcgcag
atcggttgggacgtggaggatgtcgacctctgggaggtcaacgaagccttcgccgttgtg
cccatggccttcatgcgcgagatgggcatcccgcgtgaaaaggtgaacgtcaacggcggt
gcttgcgcgcttggccaccccatcggggcgtctggtgcgcgcatcatggtgacgctcttg
aacgcgttggaaaagcgcggcctcaagcggggaattgccgccatctgcatcggcggcggc
gagggaacggccatcgcgatcgaacgcgcctga

DBGET integrated database retrieval system