KEGG   Ruegeria sp. TM1040: TM1040_0164Help
Entry
TM1040_0164       CDS       T00359                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
sit  Ruegeria sp. TM1040
Pathway
sit03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TM1040_0164
DNA repair and recombination proteins [BR:sit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TM1040_0164
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TM1040_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ABF62897
RoseoBase: TM1040_0164
UniProt: Q1GKB9
Position
complement(180902..181501)
Genome map
AA seq 199 aa AA seqDB search
MAAQDNSDIEALIALMAKLPGLGPRSARRAVLHLIRKRALVLTPLADAMSRVAETARECL
NCGNVGTSDICALCEDETRANGELCVVEDVADLWAMERAGVFKGRYHVLGGTLSALDAIG
PEDLRIPRLVDRVSTEGVSEVILALNATIDGQTTAHYIADQLSGRVKLTSLAQGVPIGGE
LDYLDDGTISAALRARKEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcaggacaacagcgatatcgaggcattgattgcattgatggccaagctaccg
gggcttggcccccgctccgcgcgccgtgctgtgttgcacctgatccgcaagcgtgcgctt
gtcctgaccccactcgccgatgccatgagccgtgttgcagagaccgcgcgcgagtgcctc
aactgcggcaacgtgggcacgagcgacatctgcgcgctctgcgaggatgagacgcgcgcc
aatggcgaactctgcgtggtcgaggatgtggcggacctctgggcgatggagcgcgctggt
gtgttcaagggacgctatcacgtcctgggcggcacgttgtcagcacttgatgccattggc
cccgaagatctgcgcatccctcgcctcgtggatcgggtctccaccgaaggggtaagtgag
gtgatcctcgcactcaacgcgacgatcgatggccagaccacggcgcattacatcgcagat
caactgtctggacgtgtcaaactcacgtcacttgcgcagggtgtgcccatcggcggcgag
ctggactatcttgatgatggcacgatctcggctgcattgcgcgcccgcaaggaaatctga

DBGET integrated database retrieval system