KEGG   Ruegeria sp. TM1040: TM1040_0206Help
Entry
TM1040_0206       CDS       T00359                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00260  Glycine, serine and threonine metabolism
sit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01130  Biosynthesis of antibiotics
sit01230  Biosynthesis of amino acids
Module
sit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM1040_0206
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM1040_0206
Enzymes [BR:sit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM1040_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABF62939
RoseoBase: TM1040_0206
UniProt: Q1GK77
Position
223721..224980
Genome map
AA seq 419 aa AA seqDB search
MAEDLINSFMNGPDENGRFGIFGGRFVSETLMPLILSLEEEYEKAKVDPDFWAEMDDLWK
NYVGRPSPLYFAERLTNHLGGAKVYMKRDELNHTGAHKVNNVLGQILLARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFHPFLDDPSVNIIGVEAGGKGVDEKMEHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLHETGRAQYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVTKIAPELPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEEGRDLEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctcatcaatagcttcatgaacgggccggacgaaaacggtcggtttggc
atctttggcggccgctttgtcagcgagacactgatgccgctgatcctgagcctcgaagag
gaatacgaaaaggccaaggtggatccggatttctgggcggaaatggatgatctgtggaag
aactatgtgggccgcccgagcccgctctatttcgccgagcgcctgaccaatcatctgggc
ggcgccaaggtctacatgaagcgtgacgagctcaatcacaccggcgcgcataaagtgaac
aatgtgctgggtcagatcctgctcgcccgccgcatgggcaagactaggatcatcgccgaa
accggtgctggccagcatggggttgcgaccgccactgtctgtgccaagtttggtctgaaa
tgcgtggtctacatgggcgctcatgacgtacgtcgacaggcgcccaacgtgttccggatg
cgtcttcttggcgctgaggtgatcccagtcacctctggccgtggcacgctcaaggatgcg
atgaacgacgcgctgcgggactgggtcaccaatgtgcgcgacacattctactgcatcggc
accgttgcgggcccgcacccctatccggctatggtgcgcgatttccagtccgtgatcggc
aaggaagtgcgctggcagcttgcagagcaggaaggcgagggccggttgccggacacggtg
attgcggctatcggagggggctccaacgcgatgggcctgttccacccgttcctcgatgac
ccttcggtcaatatcattggcgttgaggccggcggcaaaggtgtggatgagaaaatggag
cattgcgcctcattgacaggcggccggccgggcgtgctgcacggcaaccggacctatctg
ctgcaggacgatgacggccaaatcctcgaaggcttctcgatttcggcgggcctggattac
ccggggatcgggccggagcatgcctggctgcatgagaccgggcgcgcgcaatacgtgtcc
atcaccgacaaggaagccctcgaggcgttccagctgtcctgcgcgatggaggggattatc
ccggcgctcgagccgagccacgcgctcgctcatgtcactaagatcgcaccagaactgccc
aaggaccacatcatcgtgatgaacatgtgtgggcgtggcgacaaggacatctttaccgta
gcccgccacctcgggtttgatatgtcagacaccgaagagggccgcgacctcgaagagtga

DBGET integrated database retrieval system