KEGG   Ruegeria sp. TM1040: TM1040_0735Help
Entry
TM1040_0735       CDS       T00359                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00010  Glycolysis / Gluconeogenesis
sit00620  Pyruvate metabolism
sit00640  Propanoate metabolism
sit00680  Methane metabolism
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_0735
   00620 Pyruvate metabolism
    TM1040_0735
   00640 Propanoate metabolism
    TM1040_0735
  Energy metabolism
   00680 Methane metabolism
    TM1040_0735
Enzymes [BR:sit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TM1040_0735
Lipid biosynthesis proteins [BR:sit01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TM1040_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABF63468
RoseoBase: TM1040_0735
UniProt: Q1GIP8
Position
792161..793741
Genome map
AA seq 526 aa AA seqDB search
MERLEKLHTTYAQNAGLNMTEKRIIPGLTATGGWDIPERLNMAAQAMDHPADKLAIIDLT
SGTRRDVFHRELAVMVDGLARTLLQRVAPGDRVGVLLSQSPWCVAAHLAIWKIGAVSVPL
FKLFQHDALANRVEDAGAKYVLTDREGAAQLGDLAEPLITAEIGVEGDPVPFADTGSEDP
AVIIYTSGTTGKPKGVLHGHRMLTGHLPGVSISHDHLGQPGDCLWTPADWAWIGGLFDVA
MPGLALGVPVVAARLDKFTPETCAEVMRLGEVRNVFFPPTALRMLKAAGQGLDGLRSVAS
GGEPLGAEMLAWGQRHLGVTINEFYGQTECNMTVSSCCADFPVRPGCIGKPVPGHVVEVI
DADGQPTREEGDVAVRRGSGSMMLEYWNRPDATAEKFHGDWLVTGDRGIWEAGYLRFVGR
EDDVITSAGYRIGPSEIEDCLMTHPAVATVGVVGKPDALRTEIVKAYVVLKPDHAPSEKE
LQDYVKERLASYSYPREIAFLDALPMTVTGKVIRKELKARAAGEGK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagattggaaaaattgcataccacctatgcgcagaacgcagggttaaacatgact
gagaaacgcatcattcccgggcttaccgccacaggcgggtgggacatccccgagcggctc
aatatggcggcgcaggcgatggatcacccggccgataaactcgcgatcattgacctcacc
tccgggacccgccgtgatgtgtttcatcgggaattggccgtaatggtcgatggtctggcg
cgcacattgctgcaacgtgtcgcccccggtgatcgcgtcggagtgctcttgtcgcaatca
ccttggtgtgtggcggcgcatctggcgatctggaaaattggcgcagtctcggtgccgcta
tttaaactgtttcagcacgacgcccttgccaaccgcgtcgaggatgcaggtgcgaagtat
gtgctgaccgatcgggagggcgcggcgcagcttggcgatttggccgagccgctgattacg
gcagagatcggcgtcgagggcgatccggtgcccttcgccgacactggatccgaggacccg
gcggtcattatctatacctccggtaccacgggcaaacccaagggagtcttgcacgggcac
cggatgctgacagggcatctgccgggcgtgtcgatcagtcacgaccatcttggccagccc
ggtgattgtctctggacgcctgcggattgggcgtggatcggcgggctctttgatgtcgca
atgccgggccttgcgctgggtgtgccggtcgtcgccgcgcggcttgataagtttacgcct
gaaacctgcgccgaggtgatgcgcttgggcgaggtgcgcaacgtcttctttccgcctacc
gccctgcgcatgctaaaagcagcggggcaggggctcgacggtttgcgttccgtggcctcc
ggcggagagcccctgggcgcggagatgctcgcctggggccagcgtcacctgggcgtcacc
atcaacgaattctacggccagaccgaatgcaacatgacggtgtcctcttgctgcgcggac
ttccccgtgcgccctggctgcatcgggaaaccggtgccggggcatgtggtcgaggtgatc
gacgcagacggccagcccacccgtgaggaaggcgatgtggcggtgcgccgtggttccggg
tcgatgatgctggaatattggaaccgccccgacgccaccgccgagaagtttcacggcgac
tggctggtgaccggggatcgcggcatctgggaggcgggctatctgcgcttcgtggggcgt
gaggatgacgtgatcacctctgccggttaccgcatcggcccctccgagatcgaggattgt
ctgatgactcacccggccgttgccaccgtcggtgtggtcggcaagcccgacgccctgcgc
actgagatcgtcaaggcctatgtggtgctgaaaccggaccacgccccaagcgaaaaagag
ctgcaggattacgtcaaagagcgccttgccagctattcctatccccgcgagatcgccttt
ctcgacgctttgccgatgacggttacgggcaaggtgatccgtaaagaactcaaggcgcgg
gctgcgggggaggggaagtga

DBGET integrated database retrieval system