KEGG   Ruegeria sp. TM1040: TM1040_0905Help
Entry
TM1040_0905       CDS       T00359                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00520  Amino sugar and nucleotide sugar metabolism
sit01100  Metabolic pathways
sit01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TM1040_0905
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    TM1040_0905
Enzymes [BR:sit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TM1040_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABF63638
RoseoBase: TM1040_0905
UniProt: Q1GI78
Position
966827..967888
Genome map
AA seq 353 aa AA seqDB search
MRFGATILDAEGLRLTADEKALFREAAPFGFILFARNIESGDQLRALCDEFREAAGHDCL
ITIDQEGGRVQRLRAPLAREFRPALDHVEAASDPVRAMYLRARLIAAELRDYGIDSNCAP
LADVATAETHPFLRNRCYGSNVESVAAIARACAEGHLDGGVVPVMKHIPGHGRSTMDSHH
DLPHVTAPADLLRAEDFATFAKLRDLPMAMTAHLVYDAFDPRPATLSPVMMEIIRNELGY
DGLVMTDDISMKALWQDAAQDEARTAGGPYPDDEVTWSARLARQSLDAGCDVALFCNSSL
AARAEVVASAGQMTKAAQRRAEAALACRKPPVVLDTEAVEAELSALMGGQVYG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcggggcgaccattctggacgcagaaggactgcgtctcaccgccgatgaaaag
gcgctgtttcgcgaagcagcgccttttggctttattctctttgcgcgcaatatcgagagc
ggcgatcagctgcgcgcgctgtgcgacgagtttcgcgaagccgccgggcatgactgtctg
attacgatcgaccaggaaggcgggcgcgtgcagcggcttcgtgcgccgctggcgcgggag
tttcgcccggcgctcgatcatgtggaggcggcctcggatccggtgagggcgatgtatctg
cgtgcgcgcctcatcgcggcggaactgcgcgactatggcatcgacagcaactgtgcgccg
ctcgctgatgtggcaactgcagagacccatccgttcctgcgcaatcgctgttacggatcc
aacgtcgagagcgtcgccgccattgcccgcgcctgtgccgaaggacatctggatggtggc
gtggtgccggtgatgaagcacatccccggccatgggcgatcaacgatggacagccaccat
gatctgccccatgtgaccgcccccgcggaccttttgcgcgcggaggatttcgcgaccttt
gccaagctccgggatctgccgatggcgatgacggcgcatctggtctacgacgcctttgat
ccgcgcccggcgacgctttcgccggtcatgatggagatcatccgcaatgagctgggctat
gatggtctggtgatgaccgacgacatctcgatgaaggccctatggcaggacgcggcccaa
gatgaggcgcgcaccgctggcgggccatatcccgacgacgaagtgacctggagtgcccga
ttggcgcgtcagtcccttgatgccggctgtgatgtggcgcttttctgcaattcgtcactg
gcggcacgcgccgaggttgtcgcgtccgctgggcagatgactaaggccgctcaacggcgc
gccgaggcggccctggcctgccgcaagccccctgtcgtgcttgacactgaggccgtggaa
gcggaactatctgccctcatgggcggacaggtttatggctga

DBGET integrated database retrieval system