KEGG   Ruegeria sp. TM1040: TM1040_1077Help
Entry
TM1040_1077       CDS       T00359                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00010  Glycolysis / Gluconeogenesis
sit00020  Citrate cycle (TCA cycle)
sit00620  Pyruvate metabolism
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
Module
sit_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_1077
   00020 Citrate cycle (TCA cycle)
    TM1040_1077
   00620 Pyruvate metabolism
    TM1040_1077
Enzymes [BR:sit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TM1040_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABF63810
RoseoBase: TM1040_1077
UniProt: Q1GHQ6
Position
complement(1152399..1153739)
Genome map
AA seq 446 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDTVSSGDLIAEIETDKATMEFEAVDEGVVGKIL
IAEGSEGVKVNTPIAVLLEDGESADDIDTSAATPEAAPAADAAAEEAPAAAEKAAAPAAA
TPAPAAPAAADGSRIFASPLARRIAADKGLDLSAIKGSGPRGRIIKVDVENATAAPKADA
QTDAQAAAAPAASASPAPVAAPAGPSADQVAKMYEGRSFEEVKLDGMRKTIAARLTEAKQ
TIPHFYLRRDIQLDALLKFRAQLNKQLEGRGVKLSVNDFIIKAVALALQSVPDANAVWAG
DRVLKMKASDVAVAVAIDGGLFTPVLQDADMKSLSALSSEMKDLATRARDRKLAPHEYQG
GSFAISNLGMFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHR
VIDGALGADLLKAIVDNLENPMVMLA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcccactgaaattctcatgcccgccctctctcccaccatggaggaaggcacgctggcg
aaatggctcgtcaaagaaggcgacaccgtctcctctggcgatctgattgccgaaatcgaa
accgacaaggccacgatggaattcgaggccgtggacgaaggtgtcgttggcaagatcctg
atcgccgaaggctccgagggtgtgaaggtcaacacccccatcgcggtgctgctggaagac
ggcgaaagcgccgatgatatcgacacatcggcggcaacaccggaagcggcccccgccgct
gacgcggctgccgaggaggcgcctgccgccgccgagaaagccgccgccccggctgcggca
acccctgccccggcagcgcccgctgcggcagatggctcgcgcatctttgcctcgccactg
gcgcgtcgcatcgctgccgacaagggactcgacctgagcgccatcaaaggctccggcccc
cgtggtcgcatcatcaaggtggacgtggaaaacgccaccgccgcgcccaaggccgacgca
cagaccgacgcgcaggctgccgccgcccctgcggcaagtgcctcccccgcgccagtcgca
gcccccgccggcccctccgccgatcaggtggccaagatgtacgagggccgcagcttcgag
gaagtcaaactcgacgggatgcgcaagaccattgccgcgcgtctcaccgaagccaagcag
accatcccgcatttctacctgcgccgcgacatccagctcgacgcgctgttgaaattccgc
gcgcagctcaacaagcagcttgaaggccgcggtgtgaagctctcggtcaacgacttcatc
atcaaggccgtggcgctggcgctgcaatcggtgccggacgccaacgccgtgtgggccggg
gatcgtgtgctcaagatgaaagcctccgatgtggccgttgcggtcgccatcgacggcggt
ctcttcacgccggtcctgcaagacgccgacatgaagtcgctgtcggccctgtcgagcgaa
atgaaagacctcgccacccgtgcgcgcgaccgcaagcttgcgccgcatgaataccagggc
ggctccttcgcgatctccaacctcggcatgttcggcatcgacaatttcgacgccatcgtg
aacccgccgcatgcgggtattctggccgtcggctccggcgtcaagaaacccgtggtgggc
gccgatggcgagctgaccgttgccaccgtcatgagcgtcaccatgtccgtggatcaccgc
gtgatcgacggcgcattgggcgcggacctcttgaaggccatcgtcgacaatctggaaaac
ccgatggtgatgctggcctga

DBGET integrated database retrieval system