KEGG   Ruegeria sp. TM1040: TM1040_1410Help
Entry
TM1040_1410       CDS       T00359                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00900  Terpenoid backbone biosynthesis
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01130  Biosynthesis of antibiotics
Module
sit_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TM1040_1410
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TM1040_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABF64143
RoseoBase: TM1040_1410
UniProt: Q1GGS3
Position
complement(1503751..1504938)
Genome map
AA seq 395 aa AA seqDB search
MHGVTMKKISIFGATGSIGQSTIDLIRRAPDAYDVVALSGGHNVAQLARDAIELQADIAI
TAHDARLEELRSALAGSGVEAASGAAALVEAASRPADWIMSAIVGAAGLAPGLKALEQGT
TLALANKESLVCAGALLMQTAADHGARILPVDSEHSAVFQALVGERIEEVERIIITASGG
AFRDWPLERLKTASLAEASSHPNWDMGQRITIDSASMFNKALEVIETREFFGVAPEQIEV
LVHPQSLVHALVGFRDGALMSHLGAPDMRHAIGYALHWPDRNALPVARLDLAAIGQLEFR
APDLQRYPALRLAQEVMRRGGLSGAAFNGAKERALDHFIAGRIGFLDMASLTEEGLATLE
AQPGLIDASMTLENVTRVDDLARRAVDQVVTQRTG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcatggggtcactatgaaaaagatatcgatttttggggcaacgggatcaatcgggcag
agcaccattgacctgatccgccgcgcccccgacgcctatgacgtggtggcgctcagcggt
gggcataatgtggcgcagctggcgcgggacgccatagaactgcaagcagatatagcgatc
acggcgcatgacgcccggcttgaggagctgcgctccgcgcttgcgggcagtggcgttgaa
gcggcctcgggcgcggcggccctggtggaggccgcaagccgtcctgcggattggatcatg
tcggccatcgtgggcgctgcgggtcttgcgccgggcctcaaagcgctggagcagggcacg
acgctggcgctggccaacaaggaatccctcgtctgtgcgggcgcgcttttgatgcagacc
gctgcagatcacggcgcgcggattttgcccgtggacagtgagcactcagctgtgtttcag
gcgcttgtcggcgaacgtatcgaagaggtcgagcgtatcatcatcactgcgtcgggcggt
gcctttcgggactggccgctggaacggttaaaaacggcatcattggccgaggcctcttct
catcccaattgggacatggggcagcggatcacgatcgacagtgcgtcgatgttcaacaag
gcgcttgaagtcattgaaaccagagaattctttggtgttgcgcctgagcagatcgaggta
ttggtgcatccccagtcgctggttcatgcgctggtcggatttcgcgatggtgcgctcatg
agccaccttggcgcgccggatatgcgccatgccatcggctatgcgttgcactggccggac
cgcaatgcgctgccggtggcgcggctcgatctggccgcaatcggccagctggaatttcgc
gcgcccgatcttcagcgctatccggcgctgaggcttgcgcaagaggtcatgcggcgtggc
gggctgagcggggcggccttcaacggcgccaaggaacgcgcgctcgatcactttatcgcg
gggcgcattggttttctggacatggccagcctaactgaagaaggactggcgacgctcgag
gcccaaccgggccttattgatgcctcaatgacacttgaaaacgtcacccgagttgacgat
ctggcgcgtagggcggtggatcaggtcgtgacgcaacgaacaggatag

DBGET integrated database retrieval system