KEGG   Ruegeria sp. TM1040: TM1040_2532Help
Entry
TM1040_2532       CDS       T00359                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    TM1040_2532
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     TM1040_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ABF65264
RoseoBase: TM1040_2532
UniProt: Q1GDK2
Position
complement(2672639..2673442)
Genome map
AA seq 267 aa AA seqDB search
MSFSISGKTAIVTGAANGIGLAIGRQFAREGANVMFVDHDEPTLLQELGGDVEDSNIRHF
AGDLRERLTIANLLSATIDAFDQVDILVNGARKVVPSEPLNPDDESVEFLLKQNLMSTLR
LSQHVAKRMIRQAEERDDEGPNGAIINLSSIAARRTHPDLMGYSVASAALDQMTRSLAVS
LAPHRIRVNSIAFGSVMSASMQATLKDNRSLRQDIEEHTPLNRIAPPTELTETAQFLASE
ASGFMTGQVLTLDGGRTLLDPVTAPVH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttccatctctggcaagacagccattgtgactggcgcggccaatggtatcggc
ctggcgattggtcggcagttcgcccgtgaaggtgcaaatgtaatgtttgtggatcacgat
gagccaacgctcctgcaagagctgggcggtgacgtggaggacagcaatatccgccatttc
gcgggtgatttgcgcgaacgcctgaccattgccaacctgttgtcagcgaccatcgacgcg
tttgatcaggtcgacattctggtcaatggcgcccgaaaggtcgtgcccagcgagccactg
aaccccgacgacgaaagcgttgagttcctgttaaagcaaaacctcatgtccacgctgcgt
ctgtcgcagcatgtggccaaacggatgatccgtcaggctgaggagcgtgacgatgagggc
cccaatggcgccatcatcaacctgtcgtccatcgccgcacggcgcacccaccccgacctt
atgggctattcggtggcctcggcggcgctcgatcagatgacgcgctctttggcggtttcg
cttgcgccgcaccggatacgggtgaattccatcgcgttcggttccgtgatgagcgcatcc
atgcaggcgacgttgaaggacaaccgttccttgcgccaggacattgaagagcacaccccg
ctcaatcggattgcgccgccgaccgagctgaccgagaccgcgcagtttctcgcttcggaa
gcctcgggcttcatgaccgggcaggtactgacgctcgacggcgggcgtaccctgcttgat
cctgtcacagcgccggtgcattga

DBGET integrated database retrieval system