KEGG   Ruegeria sp. TM1040: TM1040_2567Help
Entry
TM1040_2567       CDS       T00359                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00790  Folate biosynthesis
sit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TM1040_2567
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TM1040_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABF65299
RoseoBase: TM1040_2567
UniProt: Q1GDG7
Position
complement(2709688..2710257)
Genome map
AA seq 189 aa AA seqDB search
MAENRSTYLVAMGSNLEDEGTIPLEILQMCLAELSGEGFDLVAVSRFYATPCFPAGAGPD
YVNAAIVLRGAFSADETLRRLHKIETKFHRRRQQRWGMRTLDLDLLAVDQEIAPDIQTFS
HWHSLPQSEQRTKAPEHLILPHPRVQDRAFVLVPLRDIAPDWVHPVLELSVREMLKRCPA
SDVAEVRAL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaccggtcaacttatcttgtggctatgggaagtaacctcgaggatgagggt
actataccattagaaatcctgcaaatgtgccttgcggagttatcgggcgaaggtttcgac
ctagtggctgtttctcgtttctatgcaacgccttgctttccagcgggcgccgggcctgat
tatgtgaatgcggcaattgtattgcgcggcgctttttctgcggacgagacattgcgcaga
cttcacaaaatcgagaccaagtttcaccgcagaaggcaacagcgctggggcatgcggaca
cttgatctagatcttttggctgtggatcaggaaattgcgcccgatattcagacgtttagc
cattggcactcgctgcctcaaagcgagcagaggacgaaagcacccgagcatttgattctg
ccgcacccgcgtgtgcaggaccgtgcgtttgtgcttgtgccgcttcgggatattgcccca
gactgggtgcatccggttctcgagctgagcgtccgggagatgctgaaacgatgtccggcc
tctgatgtggccgaggtgcgcgccctctga

DBGET integrated database retrieval system