KEGG   Ruegeria sp. TM1040: TM1040_2626Help
Entry
TM1040_2626       CDS       T00359                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00350  Tyrosine metabolism
sit00643  Styrene degradation
sit01100  Metabolic pathways
sit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TM1040_2626
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    TM1040_2626
Enzymes [BR:sit01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     TM1040_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABF65358
RoseoBase: TM1040_2626
UniProt: Q1GDA8
Position
2759074..2759721
Genome map
AA seq 215 aa AA seqDB search
MADVVLYDYWRSSASYRLRIALNLAGIAYESRSVDLVAGAQRSPEHLARNPQGFVPVLEI
DGERFTQSLACLTYLDSTRGLGLLPQEPVARAHVEALAQSIAVDLHPVCNLSVARFGVTS
SGGSLQMGDWMRQFIGPGLEAFDRLLARWPEPGEGSFCTGARPGLADICLMPQLYNARRW
EVDLNPFPRLQRIEASCAAHPAFAAAHPDHHQPAQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtggtgctctatgactactggcgttcctccgcgagctaccggttgcggatc
gcgctgaacctcgcagggatcgcctatgagagccgctcggtcgatctggtggcgggcgcg
cagcgcagccccgagcatctggcgcgcaacccacagggttttgtgccggtgctggagatc
gacggggaacggttcacgcaatcgctggcctgtctcacctatctcgacagcacgcgcggc
cttggcctcttgccccaagagcccgtcgcacgcgcccatgtcgaggcgttggcgcagagt
atcgcggtggatctgcatccggtgtgcaacctctctgtggcgcggtttggtgtcaccagc
agcggcggcagcttgcagatgggcgactggatgcggcagttcatcggaccggggctagag
gcgtttgacaggctgcttgcacgctggcccgaaccgggggagggatccttttgcaccggc
gcgcgtccggggcttgcggacatctgcctgatgccgcagctctataatgcgcgccgctgg
gaggtggacctgaacccattcccgcgcctccagcggatcgaggccagctgcgccgcgcat
cccgcctttgcggcggcacatccggatcaccaccagccggcccagtga

DBGET integrated database retrieval system