KEGG   Ruegeria sp. TM1040: TM1040_3270Help
Entry
TM1040_3270       CDS       T00359                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00072  Synthesis and degradation of ketone bodies
sit00650  Butanoate metabolism
sit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TM1040_3270
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TM1040_3270
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     TM1040_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ABF62244
RoseoBase: TM1040_3270
UniProt: Q1GM72
Position
mega:complement(272076..272879)
Genome map
AA seq 267 aa AA seqDB search
MTDLRGKTALVTGSVQGIGLAIAEALAGAGARIAVHGLADAAQAQAAVDALRAAGAPEAR
FFDADMRDVAAIEAMMDDINAWGGLDILVNNAGIQKTARLADLDTETWDAIIGVNLSGAF
HTMRLALPKMAEKGYGRVINIASVHGIVASVAKVPYCASKFGLVGMSKVAALEYAAAGSK
REGGITVNCIGPGWTETAIIKPQVEARAAQFDGDRDKGIADLLAEKQPSRRTSDPSEIGA
LALWLCAPVAHNVTGTVIPVDGGWTAQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcttcggggaaaaacggcgctggtcacggggtcggtgcaagggatcgggctg
gccattgccgaggcgttggccggggctggcgcgcgcattgctgtgcatggcctcgcggat
gcggctcaggcacaggctgccgttgatgccctgcgcgctgccggtgcgcctgaggcgcgc
ttttttgacgccgacatgcgcgatgtcgcggctattgaggcgatgatggatgatatcaac
gcctggggcggtcttgacattcttgtcaataatgctggcatccagaaaaccgcgcggctt
gctgacctcgacaccgagacgtgggacgcgatcatcggagtgaacctttcgggtgcgttt
cacaccatgcggcttgctttgccgaagatggctgagaaaggctatggccgggtcatcaat
atcgccagcgttcacggcatcgtcgcctcggtcgccaaagtgccctattgcgcctcgaag
tttgggctggtgggcatgtcgaaagtggctgcgctggaatacgcggcggcgggctccaag
cgcgaaggcggcatcaccgtcaactgcatcgggcctggctggacagaaactgcaatcatc
aagccgcaggtcgaggcgcgcgcagcgcagtttgatggcgaccgcgacaaggggattgct
gatctgctggcggaaaaacaacccagtcggcgcacctctgatccttcggagatcggtgcg
cttgcgttgtggctctgtgcgccagtcgcccacaatgttaccggcacggtgatcccggtc
gatggcggctggacggcgcaatag

DBGET integrated database retrieval system