KEGG   Ruegeria sp. TM1040: TM1040_3492Help
Entry
TM1040_3492       CDS       T00359                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TM1040_3492
Enzymes [BR:sit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TM1040_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_35 GHL6
Motif
Other DBs
NCBI-ProteinID: ABF62464
RoseoBase: TM1040_3492
UniProt: Q1GLK2
Position
mega:524505..526412
Genome map
AA seq 635 aa AA seqDB search
MKRTLGTCYYPEHWPEEIWAEDAARMKAAGLTWIRIGEFSWSKLEPTPGDLHWDWLDRAI
ETLGAQGLRVVLGTPTATPPRWMAERHPDMFAVTAEGQPRGFGSRRHYCFSHKGYFAESQ
RITRLMAERYGANPHVAAWQTDNEYGCHDTVISYSDAAQTAFRAWLAEQFDGEIGALNAA
WGNMFWSMEYRSFDEIGLPNLTVTEPNPAHVLAFRRFSSDQVVAFNRAQVEIIKAHSTAP
ISHNYMGRITDFDHFKLGEDLEIATWDSYPLGFLEDRVGASPEEQRAYARQGDPDFQALH
HDLYRAVGRGRWWVMEQQPGPVNWAPYNPAPLPGMVRLWTWEAFAHGAEAVCYFRWRQAP
FAQEQMHAGLLRPDSQDAPAMQEAMDVAAELGAAADVQPAQAPVAILFDYDADWAWSTQP
HGAGLSYFQLILEHYKALRRAGQTIDILPPETRDFTGYKMILAPGMMHLPEPLKEALARS
EAEVLYGPRSGARDGHFSIPTSPLPPALPGLDVTVARVESLRPDMPIALKGGGAVRGYLE
ELEGTAEVVFETSEGAAVALRAGRQTYCGGWLDAEGLDRLIATVAQAAGLELRQMPEGVR
TRRTATEVFWFNHSAEPVETEVGLLPPAGVKRIAL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaacccttggcacctgctattaccccgagcactggccagaagagatctgggcc
gaagacgccgcgcgtatgaaagctgcgggcctgacgtggatccggattggggaattttcg
tggtcgaaactcgaacccactcccggcgatctgcactgggactggctcgaccgcgcgatc
gagacattgggggcgcaaggcttgcgggtggtgctcggcacccccacagcgaccccgccg
cgctggatggccgagcgtcacccggacatgtttgctgtcaccgccgagggccagccacgc
ggctttggctcccggcggcactattgctttagccacaagggttattttgccgagagccag
cgcatcacccgcctgatggcagagcgctatggtgccaacccgcatgtggccgcgtggcag
accgacaatgaatatggctgccatgataccgtgatcagctattccgacgcggctcaaacc
gcttttcgggcgtggctggcagagcagttcgacggcgagatcggcgcgctcaacgcggcc
tggggcaatatgttctggtccatggagtatcgcagctttgacgaaatcggcctgcccaac
ctcaccgtgacggagccgaacccggcgcatgtgctggcgttcagacgcttcagctccgat
caggtggtggctttcaaccgcgcgcaggtcgagatcatcaaggcccattcaaccgcgccg
atttctcataactacatggggcggatcaccgatttcgaccacttcaaactaggtgaggat
ctcgagatcgcgacctgggacagctacccgctgggctttctggaagaccgcgtgggggcc
tcacccgaggaacagcgcgcttatgcccggcagggggatccggattttcaggcccttcat
cacgatctctatcgcgcggttgggcgcgggcgctggtgggtcatggaacagcagccgggg
ccagtgaactgggcgccctacaacccggcacccctgccgggcatggtgcggctctggacc
tgggaggcctttgcccatggcgccgaggctgtgtgttatttccgctggcggcaggcgcct
tttgcgcaggaacagatgcacgcaggcctcttgcgtcccgacagccaggacgcccccgcc
atgcaagaagcgatggatgttgcggcagagcttggcgcggcagccgatgtgcagcccgcg
caggcaccggtggcgatcctttttgattacgatgccgattgggcgtggtcgacgcagccg
catggtgcagggctgagctatttccagctgatcctcgaacactacaaggcgcttcggcgc
gctggtcagaccatcgacatcctgcccccggagacccgcgatttcacggggtacaagatg
atccttgcgcccgggatgatgcatctgccagagcccctcaaagaagcgctcgcaagaagt
gaggccgaggtgctctatggtccgcgcagcggtgcgcgtgacggtcatttctccatcccg
accagcccactgccacctgcattgccggggctggacgtgaccgtggcacgggtggagagt
ctgcgcccggatatgcccatcgcccttaagggcggtggtgcagtgcgcggctatcttgag
gagcttgaaggcactgcagaagtggtctttgaaacctccgagggcgcggcggtcgcgctc
cgggccgggcgacagacttattgtggcggctggctcgatgcagaggggcttgatcggttg
attgccaccgttgcgcaggcggcgggtctggagttgcgccagatgccggaaggggtgcgc
acccgccgcacggcaaccgaggtcttctggttcaaccacagcgcagagcctgtcgaaacc
gaagttggcctcttgcctccggcgggggtgaaacggatcgcgctttag

DBGET integrated database retrieval system