KEGG   Setaria italica (foxtail millet): 101752761
Entry
101752761         CDS       T02818                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00100  Steroid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Module
sita_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101752761
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101752761
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 101752761
NCBI-ProteinID: XP_004956192
UniProt: K3ZUC2
Position
II
AA seq 374 aa
MEAATAAAAAVLPALVPSGSAVVVLFAYLGYLAAAGAILPGKLVAGAVLQDSSRLHYRCN
GLLSLLLLLGLLAFGSYMGWMSPTVVADRGLELLSATFIFSVIVTFALYFAGTKSRHKSS
SLRPHVSGSFIQDWWLGVQLNPHFMGVDLKFFFVRAGMMGWLFINLSLFAKSYLAGSVNL
SVILYQFFCAWYIIDYFVHEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLRN
EVKLSPLAGLANFCIFIIGYLVFRGANKQKHVFKKDPKAPIWGKPPKVVGGKLLASGYWG
IARHCNYLGDLLLALSFSLPCGFSSVIPYFYPTYLLILLIWRERRDEARCSQKYKEIWAE
YCKLVPWRILPYVY
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggaggccgccaccgccgccgccgccgccgtcctccccgcgctggtgccctccggtagc
gcggtggtggtgctattcgcctacctcggctacctcgccgccgccggagccatcctcccc
gggaagctcgtcgccggcgccgtcctccaggattcctcccgcctccactaccgctgcaat
ggtttactctcgctcctgctgctactgggcctcttggcgttcggttcctacatgggttgg
atgtctcccacggttgtggctgacaggggacttgagcttctatcagcgaccttcattttt
agtgttattgtcacttttgcactctactttgccggcaccaagtcccgccacaaaagttct
tctttgaggccacatgttagtgggagcttcatacaagattggtggttgggagtgcagctt
aatcctcattttatgggagttgacctcaaattcttcttcgtgagggcaggaatgatggga
tggttatttatcaacctctctttgtttgcaaagagctacctagctggttccgtcaatctt
tcagtcattctctaccaattcttttgtgcgtggtatattatagattacttcgtccatgaa
gaattcatgacctcaacgtgggacattattgctgaaaggttgggtttcatgctggtgttt
ggtgatctagttttcattcctttcaccttcactattcagggttggtggcttttgagaaat
gaagtgaagctgtcacctttggctggtctagctaacttttgcatcttcattattgggtac
ctagtgttcagaggagctaacaagcaaaaacatgttttcaagaaggaccccaaagctcct
atatggggaaaacctcccaaagtcgtcgggggaaagctacttgcatccggctactggggc
attgcaaggcactgcaattacctaggagatctactgctagcgctttcgttcagcctgccc
tgcgggttcagctctgtgatcccgtacttctacccgacctacctgctgattctgctgatc
tggagggagaggcgcgacgaggctaggtgctcgcagaagtacaaggagatctgggcagag
tactgcaagctcgtgccctggaggatcctaccttatgtgtactag

DBGET integrated database retrieval system