KEGG   Setaria italica (foxtail millet): 101754899Help
Entry
101754899         CDS       T02818                                 

Definition
(RefSeq) leucoanthocyanidin dioxygenase
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00941  Flavonoid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Module
sita_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101754899
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     101754899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N Lipase_GDSL_2 RES
Motif
Other DBs
NCBI-GeneID: 101754899
NCBI-ProteinID: XP_004951171
Position
I
AA seq 397 aa AA seqDB search
MEMEPCSSPVPVPAPPQQKQLPARVEALSGLSAIPAEYVRPADERADLGDALELARTHAD
DHTAPRIPVVDISPFLLACSKDDDAKQQNEQLSECVEAVRAAAAEWGVMHISGHGIPGEV
MDRLRAAGAAFFALPIEAKEAYANDPAAGRLQGYGSRLATNASGQREWEDYLFHLLHPDG
LADHALWPAHPPDYVAATRDFGRRIRDLASALLAVLSVGLLGPGRGEALEKALITRAGEH
EHDDDLRLQLKINYYPRCPQPELAVGVEAHTDVSALSFIIHNGVPGLQVRHGGRWVTARD
EPGTIIVHVGDALEILSNGRYTSVLHRGLVNRDAVRVSWVVFCEPPPDLVLLRPMPELVT
PDNPARFTPRTFKQHIDSKLFKKHQQLAVTDDDEQTN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagccttgttcatccccggtgccggtgccggcgccgccgcagcagaagcag
ctgcccgcgcgcgtggaggctctcagcggcctgtccgccatcccggccgagtacgtacgc
cccgccgacgagcgagccgacctcggagacgccttggagctggcgcgcacccacgccgac
gaccacacggcgccgcggatccccgtcgtcgacatctccccgttcctgctcgcctgcagc
aaggacgacgatgccaagcagcagaatgagcagctgtcggagtgcgtggaggccgttcgc
gccgccgccgccgagtggggcgtgatgcacatctccggccacggcatccccggcgaggtc
atggaccgcctgcgcgccgccggcgccgccttcttcgcgctccccatcgaggccaaggag
gcctacgccaacgaccccgccgccgggcggctgcaggggtacggcagccggctggccacc
aacgccagcgggcagcgcgagtgggaggactacctcttccacctcctccaccccgacggc
ctcgccgaccacgccctctggcccgcgcacccgcccgactacgtcgccgccacgcgcgac
ttcggccgccgcatccgcgacctggcctccgcgctgctcgccgtcctctccgtggggctc
ctcggcccaggccgcggggaggccctcgagaaggcactcatcacccgggccggcgagcac
gaacacgacgacgacctccggctgcagctgaagatcaactactacccgcggtgcccgcag
ccggagctggccgtgggcgtggaggcccacacggacgtgagcgcgctgtccttcatcatc
cacaacggcgtgccggggctgcaggtgcgccacggcggccgctgggtgacggcgcgcgac
gagccgggcaccatcatcgtgcacgtcggcgacgccctcgagatcctcagcaacggccgc
tacaccagcgtgctgcaccgcggcctcgtcaaccgcgacgccgtgcgcgtctcctgggtc
gtcttctgcgagccgccaccggacctcgtgctgctgcgcccgatgccggagctcgtcacg
ccggacaaccccgccaggttcacgccgcgaaccttcaagcagcacatcgacagcaagctc
ttcaagaagcaccagcagcttgcagttactgatgatgatgagcagaccaactga

DBGET integrated database retrieval system