KEGG   Setaria italica (foxtail millet): 101755663Help
Entry
101755663         CDS       T02818                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00052  Galactose metabolism
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101755663
   00500 Starch and sucrose metabolism
    101755663
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101755663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101755663
NCBI-ProteinID: XP_004963401
Position
III
AA seq 556 aa AA seqDB search
MNGKQPSRHDHGRTAYHFQPAKNWMNDPNGPFYHNGIYHFFYQYNPHGPTFGTGKLSWGH
SVSGDLVNWAFLGAALEPTSPFDADGCWSGSATVLPDGRPVILYTGRDTDTVQVQNVAFP
KDPTDPLLREWHKPSCNPVIPQPADVTGNNFRDPSTAWLGGDGLWRFSVAAEVAGVGSTL
VYRSADFLRWERNATPLHASPDVPALECADFFPVAERGTEGLDTSAANVAGVRHVLKLSN
MADEDYYMVGWYDDAADTFVPAEGERGSDVRKWRRIDHGHLFGAKSFFDASKKRRVLWAW
VDETDGHSDDVAKGWAGIQAFPRALWLDTDGKQLVQWPVEEIETLRRRRVALLGAEVGSG
GLHEIAGIETQQADVEAIFEIPKLEAAEKFDPKWLQDPGKLCSESGGVGPFGLIAMASGD
LQEQTAIFFRVFKHDDMYKVLMCMDLTRSSTKEGVYKPVHAGFVDVNVEKDRSLSLRTLI
DHSVIESFGGGGRTCITARVYPEHAATGSSHLYLFNNGSGSVKVSKLEAWELGTASVNLE
DVNLPLAVPILSNVSE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaagcagccctcccgccatgaccatggcagaactgcctaccacttccagcct
gccaagaactggatgaacgatccaaatgggcctttctaccacaacggcatataccatttc
ttctaccagtacaacccgcacggcccgacgtttggcaccggcaagctctcctggggccac
tccgtctccggcgacctcgtaaactgggccttcctcggcgccgcgctcgagccgacgtcg
cccttcgacgccgacggctgctggtcgggctcagcgaccgtcctccccgacggccgtccg
gtcatcctctacaccgggcgcgacaccgacacggtccaagtgcagaacgtggcgttcccc
aaggaccccacggacccgctcctccgcgagtggcacaagcccagctgcaacccggtgatc
ccgcagcccgcggacgtgacgggcaacaacttccgcgatccctccacggcgtggctcggc
ggcgacgggctgtggaggttcagcgtcgccgccgaggtcgccggcgtcggctccacgctc
gtctaccgcagcgcggatttccttcgctgggagcggaacgccacgccgctgcacgcctct
ccggacgtcccggcgctcgagtgcgccgactttttcccggtggcggagcgcggcacggag
gggctcgacacgtcggcggcgaacgtcgccggggtgaggcacgtgctcaagctgagcaac
atggccgacgaggactactacatggtcgggtggtacgacgacgcggcggacacgttcgtg
ccggcggagggggagcgcggtagcgacgtgaggaagtggcgccggatcgaccacgggcac
ctgttcggcgccaagtccttcttcgacgcgagcaagaaacggcgcgtgctttgggcgtgg
gtcgacgagacggacggacactccgacgacgtcgccaagggctgggccggaattcaggcg
ttcccgagagccctctggctggacaccgacgggaagcagctggtgcagtggccggtggaa
gagatcgagacgctgcggaggagacgagtcgctctgctgggcgcggaggtgggctcgggc
gggctccatgagatcgccggcattgagacccagcaagcggacgtggaggcgatcttcgag
atcccgaaactggaggcggccgagaagtttgatcccaagtggctgcaggatcccgggaag
ttgtgctcagagagcggcggcgtcgggccgttcgggctgattgccatggcgtccggcgac
ttgcaggagcagactgccatcttcttcagggtgttcaagcacgatgacatgtacaaggtc
ctcatgtgcatggatctgacaaggtcatctacaaaagaaggggtgtacaagccagttcat
gcaggatttgtcgacgtgaacgtggagaaagacaggagcttatctctaaggacactgatc
gatcactctgtcattgagagttttggaggtgggggccggacgtgcatcacggctcgagtg
tacccagagcacgccgcaacaggcagcagccacctgtacctgttcaacaacggatctggc
tcagtgaaggtgtccaagctcgaggcctgggagcttgggacagcgtccgtcaatcttgaa
gatgtcaatcttccattggctgttcctattctttcgaatgtctccgaatag

DBGET integrated database retrieval system