KEGG   Setaria italica (foxtail millet): 101755850Help
Entry
101755850         CDS       T02818                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sita01002]
    101755850
Enzymes [BR:sita01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     101755850
Peptidases and inhibitors [BR:sita01002]
 Metallo peptidases
  Family M16: pitrilysin family
   101755850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 101755850
NCBI-ProteinID: XP_004970177
UniProt: K3XE64
Position
V
AA seq 973 aa AA seqDB search
MAAAVAAPAGSRDVEFIRARSDKREYRRVVLPNALEILLISDPDTDKAAACMEVEVGSFS
DPEGLEGLAHFLEHMLFYASEKYPGEHEYTKYITEHGGSYNAYTSSETTNFYFDVNVDNF
EEALDRFAQFFIKPLMSQDAVLREIKAVDSEHKKNLLSDGWRMYQLQKHLASKDHPYHKF
STGSWETLETKPKGRGLDIRDELLKFYENYSANLMHLVVYGKESLDCTQGLVERMFSDIK
NTDQRSFKCPSHPLSEEHLQLIVKALPIEEGDYLRIIWPITPTIQFYKEGPCHYLSHLIG
HEGEGSIFHIIKELGWAMNLMAGESTDSTEYSFFSISMRLTDAGHEHVEDIVGLIFKYLL
LLKEDGVHEWIFNELVAINETEFHYQDKVHPISYVTGTVSSMRLFPPEEWLVGSALPSKY
APQRIRMILDQLSPERVRIFWESKKFEGSTTSSEPWYDTPYSVENVTPPVIQKWIKKAPT
EKLHIPEPNIFIPKDLSLKEVHEKVTFPTVLRKTPLSRLWYKPDLLFSTPKVHIIIDFHC
PLSSHSPEAIISTDLFVDLLVDYLNAYAYDAQIAGLYYSIYLTSAGFQVSLGGYNDKMRV
LLNAILKQIANFEVKPNRFSALKETSAKDYQNFNFSQPHKQASYYVSLILEDKKWPVAEK
LEALLKLESDSLAKFLPNLLSKTFLECYIQGNIEPSEARSIAQEIEDTIFNTPNTMFKCI
SPSQYLTKRVIMLENELKCYYQIEGLNQKNENSSVIQYIQVHQDDASSNIKLQLFSLIAS
QPAFNQLRTVEQLGYITSLSLRSDYGVWALQVVIQSTVKDPAYLDARVDEFFKMFESKIH
ELSDKDFKRNVKSLIDSKLEKFKNLWEESHFYWGEIDAGTLKFDRVESEVALLRELKKEE
FIAFFDQYIKLDAPERRTISVQVFSGNHSAEFKKAVAEADPPKTYRITDIFGFKRSRPLY
SSLKGGPGRITMD
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtggcggcgccggcgggaagcagggatgtggagttcatccgcgcgcgc
agcgacaagcgggagtaccgccgggtggtgctccccaacgcgctcgagatcctgctcatc
agcgaccccgacaccgacaaggcggcggcgtgcatggaggtcgaggtgggctcgttcagc
gacccggaggggctcgagggcctcgcgcacttcctcgagcacatgctattttatgccagc
gagaaataccctggagaacatgagtatacgaaatatatcacagagcatggtggctcttac
aatgcatatacgagctcagagacaacaaatttctattttgatgtcaatgtggacaatttt
gaagaagctttagataggtttgctcagttctttattaagccgctgatgtcacaggatgct
gttcttagagagataaaagctgttgattctgagcacaagaaaaatttgttgtctgatggc
tggagaatgtatcagcttcaaaagcatctggcttcaaaggatcacccttaccataaattc
agtactggaagttgggagacactagaaactaaaccaaaagggaggggcttggacatcaga
gatgaacttctgaagttttatgagaattattcagcaaatcttatgcaccttgttgtttat
ggaaaggagagcctcgattgcactcagggcttggtcgagcgtatgtttagtgacataaag
aacactgaccagagaagcttcaaatgtccaagtcatcctctttcagaggaacatttacag
cttattgtcaaagcactgccaatagaagaaggtgactatctaagaataatatggccaatt
acacctaccatccagttttacaaagaagggccttgccattatctgagtcaccttattggg
catgaaggcgagggctccatcttccatattataaaggaactaggatgggccatgaacttg
atggctggagagagcactgacagcactgaatattcctttttctcaataagcatgaggctc
actgatgctggtcatgaacacgtggaggatattgttggattgatcttcaaatatcttctt
ctattaaaagaagacggagtccatgagtggatatttaatgagcttgtggcaataaatgaa
acagagttccattatcaagacaaagtccatccaatcagctatgtgacgggtactgtctca
agtatgcggttgttcccaccagaagagtggctggttggatcagcattgccatcaaagtat
gcgccacagagaataaggatgatactcgatcagttgtcacctgaaagagtaagaatattc
tgggagtccaaaaaatttgaaggatctactacctcttctgagccctggtatgatacacca
tattctgttgaaaacgttactcctcctgtgatacagaaatggattaaaaaagctcctaca
gagaaactccatatcccagagcctaatatattcattccaaaggatttatctcttaaagaa
gtgcatgaaaaggttacttttccaacagtattaaggaagacaccactttcacggttgtgg
tataagcctgacttgctgttctccacaccaaaggttcacattataattgatttccattgc
ccattatcaagccactctcccgaagcaatcatttctactgatctctttgttgatttatta
gtggattatttgaatgcttatgcttatgatgctcaaattgccggcttatactattcaatc
tatcttacttcagcaggattccaggtctccttaggtggttacaatgataagatgagggtt
ctcctaaatgccatactgaagcaaattgctaattttgaagttaagcctaataggttttct
gccctgaaggaaacttctgccaaagactaccaaaattttaatttcagtcaaccgcataaa
caagcttcatactatgtttctttaatattggaagataaaaaatggcctgtagctgagaaa
cttgaagctcttttgaagcttgaatcagattctctcgccaagtttttaccaaacttgcta
tcgaagacatttttggaatgttatattcaaggaaacattgaaccaagtgaggcaagatct
attgcgcaggagattgaggacaccatattcaatacccccaatactatgttcaaatgcatt
tctccatcacaatatctgactaaaagggttatcatgcttgaaaatgagttgaaatgctac
taccaaattgagggcttaaatcagaaaaatgagaattcatcagttatccaatatattcag
gtacatcaggatgatgccagctcgaatatcaaacttcagctgttctctttaattgctagc
cagcctgccttcaaccagctacgaacagttgagcagcttgggtatataacaagtctttct
ctaagatctgactatggagtctgggcactccaggtggttattcagtccacagttaaggat
cctgcataccttgatgctagagttgatgaattcttcaagatgtttgaaagcaaaatccat
gaactgtctgacaaggatttcaagagaaatgtgaaatcactcattgactctaaactggag
aagttcaaaaacttatgggaggaatcccatttctactggggagagattgatgcgggaact
ctcaagtttgacagggtcgagtcagaggtcgctctcctaagagagctcaaaaaagaagaa
ttcattgcgttcttcgatcagtacataaaactggatgcgcctgaaaggaggacaataagc
gtgcaagtcttcagtggcaaccattcggcagagttcaagaaggcggttgccgaagctgat
ccgccgaaaacgtacaggatcacagacatattcggcttcaaacgatcgaggccgctgtac
agctcgctcaagggaggtccgggcaggatcacaatggactga

DBGET integrated database retrieval system