KEGG   Setaria italica (foxtail millet): 101756933Help
Entry
101756933         CDS       T02818                                 

Definition
(RefSeq) transcription factor bHLH83
Organism
sita  Setaria italica (foxtail millet)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 101756933
NCBI-ProteinID: XP_004971598
UniProt: K3XS23
Position
V
AA seq 297 aa AA seqDB search
MAQAASKRGGMQQQLRPTVMYDDEPSAMSLELFGYHGGGVVDGDGAALSLQLAFDDDNFK
HGGGCGGASAGGDYYGGWAGYGGSGGASSSSSSSVLSFEQAGSGGGHHHLAYGDDGCALW
MDAAAGMVENPAQQHGSACRFGLVSPGSSADDDTGLHFQELGSVQPPAKATNKRARPDGE
VQAAVAKKQCGGSGGRKSKAKAAPAPTKDPQSVAAKVRRERIAEKLKVLQDLVPNGTKVD
LVTMLEKAITYVKFLQLQVKVLAADEFWPAQGGKAPELSQVKDALDALLSSQQYPNK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcagcaagcaagcgcggtggtatgcagcagcagctccggccaacggtgatg
tacgacgacgagccatccgccatgtcactcgagctcttcggctaccacggcggcggcgtc
gtggacggcgacggcgcggccctctcgctgcagctcgccttcgacgacgacaacttcaag
catggcggcgggtgcggcggcgcctcggccggcggcgactactacggcggctgggccggg
tacggcggctcgggcggcgccagctccagctccagctcgtcggtgctcagcttcgagcag
gccggcagcggcggcggacaccaccacctcgcctacggcgacgacgggtgcgcgctgtgg
atggacgccgccgccggcatggtcgagaatccggcgcagcagcacggatccgcctgcagg
tttgggctcgtgagcccaggcagctcggccgatgatgataccggcctacacttccaggag
ctcggctccgtccagccgccggccaaggccacgaacaagcgcgcacgtccggatggtgag
gtgcaagctgcagtggcgaagaagcagtgtggcggcagcggcggcaggaagagcaaggcc
aaggctgctccggctcctaccaaggaccctcaaagcgtagctgcaaaggttcgaagagag
aggatcgccgagaagctcaaagtcctgcaagatcttgtgcccaatggcaccaaggtggat
ttggtcaccatgctagagaaggcgatcacctatgtcaagttcctccagctgcaagtcaag
gtgttggctgccgatgagttctggcctgcacaaggagggaaggcaccggagctctctcaa
gtgaaggacgccttggacgccctcctgtcgtcccagcagtaccctaacaaatga

DBGET integrated database retrieval system