KEGG   Setaria italica (foxtail millet): 101759813Help
Entry
101759813         CDS       T02818                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00020  Citrate cycle (TCA cycle)
sita00640  Propanoate metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101759813
   00640 Propanoate metabolism
    101759813
Enzymes [BR:sita01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101759813
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101759813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101759813
NCBI-ProteinID: XP_004958125
UniProt: K3ZV34
Position
II
AA seq 332 aa AA seqDB search
MAAASSRRASQLLGSAASRLLHARGFAAAAAAAPSPAVFVDKSTRVICQGITGKNGTFHT
EQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEA
MEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHK
PGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGI
VLIGEIGGTAEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI
KALREAGVTVVESPAKIGSTMFEIFKQRGMVE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcctcctcccgccgcgcgtcgcagctgctggggtccgccgcctctcgcctc
ctccacgcgcggggcttcgccgcggcggccgccgccgcgccctcgccggcggtcttcgtc
gacaagagcacccgcgtgatctgccagggcatcacggggaagaacggcaccttccacacc
gagcaggccatcgagtacggcaccaacatggtcggtggagtgactcctaagaaaggtgga
actgaacatttagggctcccagtgtttaactccgtagcagaggctaaggctgaaacaaaa
gccaatgcatctgttatatatgttccgccaccatttgccgctgctgctataatggaggca
atggaggctgagctcgaccttgttgtctgcattacagaaggaattcctcagcatgacatg
gtgaaagtgaaggctgcactaaacaggcagtcaaaaactcgattgattgggccaaattgc
cctggtatcattaagcctggtgaatgtaaaattggaatcatgcctggttacatccacaag
ccagggcgtgttgggattgtatctcgttctggtaccttgacatatgaagcggtgtttcaa
acaacagctgtaggtctggggcagtcaacttgtgtaggcattggtggtgacccattcaat
ggcacgaattttgttgattgccttgaaaagtttgttgatgatcctcagacagaaggtatt
gttctcattggtgaaattggaggtactgctgaggaggatgctgcagcattcatccaggaa
agcaaaacacaaaagcctgttgttgcattcattgctggacttacggcacccccgggtcgt
cgcatgggtcatgctggagcgattgtgtcaggaggaaagggtacagcccaggacaaaatc
aaggcactccgagaggctggtgtgactgtcgtggagtcgccagcaaaaattggttctacc
atgtttgaaatcttcaagcagcgtggaatggtagagtag

DBGET integrated database retrieval system