KEGG   Setaria italica (foxtail millet): 101763001Help
Entry
101763001         CDS       T02818                                 

Definition
(RefSeq) bifunctional riboflavin kinase/FMN phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
sita  Setaria italica (foxtail millet)
Brite
KEGG Orthology (KO) [BR:sita00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    101763001
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     101763001
Protein phosphatases and associated proteins [BR:sita01009]
 HAD phosphatases
  Other HAD phosphatases
   101763001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 Flavokinase
Motif
Other DBs
NCBI-GeneID: 101763001
NCBI-ProteinID: XP_004970015
UniProt: A0A368RBH0
Position
V
AA seq 367 aa AA seqDB search
MAAAHQVSAVIFDLDGTLLDTERATRDVLNEFLASYEKVPDPEKEEKRLGQMYMESTTGI
IRDYGLPLTVEEYSKAMHPLYLKRWQKAKPLPGVKRLVKHLYKNGVPLALASNSIRRNID
HKLPKLEDWGECFSVILGGDQVPNGKPSPDIFLEAAKRLGVNPSSCLVIEDSVVGVKGAK
ASGAKAVAVPSLQSQRKHYYIADIILYSLLDFDPELWGLPPFEDRVHGVLPIDPLLSTAQ
IGDRILNNLHRVISDVHTYECIPDQISGIYMGWARSKVHGFSKVVIGTGWDFSQQTVERV
MVVEFLDSTGKIETEPVKLLVIGYIRKLQSTDDMLQALSVTDEDRSIARDGLDLPTFSEY
AHDLHFP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcacaccaggtctccgccgtgatcttcgacctcgacggcaccctcctggac
acagagagggcgacgagggatgtcttgaacgaattcttggcgtcgtacgagaaggtccct
gacccggagaaggaagagaagaggctgggccagatgtacatggaatccaccaccgggatc
atcagagattacgggctgccgctgaccgtcgaggagtactccaaggcgatgcatccactc
tacctgaaaaggtggcaaaaggcaaagccgcttccaggagtgaagaggcttgtcaagcat
ctttacaagaatggagtgccactcgcacttgcttcaaactccatcaggagaaatattgat
cacaagcttccgaaactagaagattggggagagtgtttttctgttattcttggtggagat
caagtccctaatggaaaaccttcccctgacatatttctggaagctgcaaagagacttggc
gtaaatccatcatcatgcttggtcatagaagattctgtcgttggagtcaagggtgccaag
gcttctggggcaaaggcagttgcggtaccatcacttcaaagtcaaaggaagcactattac
attgccgatatcatcctctattcgcttttggacttcgatcctgagctgtggggtcttcct
ccatttgaagatcgcgtccatggtgttttgcccattgatcccttactttcaactgctcaa
ataggtgataggattttaaacaatcttcatagggtaatttcagacgtacatacctacgaa
tgtattcctgaccaaatatcaggaatttatatgggttgggccaggtccaaagtgcatgga
ttctctaaggtggtcattggtactgggtgggacttttcacagcagaccgtcgagagagtg
atggtagtagagtttcttgattccactggcaagattgaaacagagcctgtgaagcttctt
gtaattggttacatccggaagctacaaagcacagatgatatgttgcaagctttaagtgta
actgacgaagacaggagcattgcaagggatggactggacctcccaactttctctgaatat
gcccacgaccttcattttccctga

DBGET integrated database retrieval system