KEGG   Setaria italica (foxtail millet): 101764060Help
Entry
101764060         CDS       T02818                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03040  Spliceosome
sita04141  Protein processing in endoplasmic reticulum
sita04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101764060
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101764060
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101764060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    101764060
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sita03041]
    101764060
   03009 Ribosome biogenesis [BR:sita03009]
    101764060
   03110 Chaperones and folding catalysts [BR:sita03110]
    101764060
   04131 Membrane trafficking [BR:sita04131]
    101764060
   03051 Proteasome [BR:sita03051]
    101764060
   03029 Mitochondrial biogenesis [BR:sita03029]
    101764060
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101764060
Protein phosphatases and associated proteins [BR:sita01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101764060
Spliceosome [BR:sita03041]
 Complex B
  Other components
   Prp19 complex
    101764060
 Complex C
   Prp19-CDC5 complex
    101764060
Ribosome biogenesis [BR:sita03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101764060
Chaperones and folding catalysts [BR:sita03110]
 Heat shock proteins
  HSP70 / DNAK
   101764060
Membrane trafficking [BR:sita04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101764060
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101764060
Proteasome [BR:sita03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101764060
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101764060
Exosome [BR:sita04147]
 Exosomal proteins
  Proteins found in most exosomes
   101764060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 101764060
NCBI-ProteinID: XP_004984739
UniProt: K4A6U9
Position
IX
AA seq 649 aa AA seqDB search
MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVVPGSAEKPMIGVQFRGEEKQFSA
EEISSMILNKMKETAEQYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKSSSDGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVSPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVDAKNSLENYAYNMRNTIRDDKIASKLPEADKKKIDEAIEGAITWLDNNQLAEVDEFED
KMKELEGICNPIIAKMYQGAAGPDMAGGMAEDAPAAGGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaagggagacgggccagctatcgggatcgacctcggcacgacctactcgtgc
gtcggggtctggcagcatgaccgcgtcgagatcatcgccaacgaccagggcaaccgcacc
acgccgtcgtacgtcgcgttcaccgactccgagaggctcatcggcgacgccgccaagaac
caggtcgccatgaaccccatcaataccgtcttcgatgccaagcggctcatcggccggcgc
ttctcggatgcgtcggtgcagagcgacatcaagctgtggcctttcaaggtggtcccgggc
tccgccgagaagcccatgatcggggtgcagttcaggggcgaggagaagcagttctcggcc
gaggagatctcctccatgatcctcaacaagatgaaggagacggccgagcaatacctcggc
agcaccgtcaagaacgccgtcgtcaccgtcccagcctacttcaacgactcccagcgccag
gccaccaaggatgccggcgtcatctccggcctcaacgtcatgcgcatcatcaacgagccc
accgccgcggccatcgcctacggcctcgacaagaagtcgagcagcgacggcgagaagaac
gtcctcatcttcgacctcggcggcggcacctttgacgtctctctcctcaccatcgaggag
ggcatcttcgaggtcaaggccacggccggcgacacccacctgggaggcgaggacttcgac
aaccgcctcgtgaaccacttcgtgcaggagttcaagaggaagaacaagaaggacatcagc
ggcaaccccagggcgctccggcggctcaggacggcctgcgagagggccaagaggacgctc
tcctccaccgcgcagaccaccatcgagatcgactccctctacgagggcatcgacttctac
acgaccatcacccgcgcccggttcgaggagctcaacatggacctgttccgcaagtgcatg
gagcccgtggagaagtgtctccgcgacgccaagatggacaagagcagcgtgcacgacgtc
gtgctcgtgggcggctccacgcgcatcccccgcgtgcagcagctgctccaggacttcttc
aacggcaaggagctctgcaagagcatcaaccccgacgaggccgtcgcgtacggcgccgcc
gtccaggccgccatcctcaccggcgagggcaacgagaaggtgcaggacctgctcctgctc
gacgtctcgccgctctcgctcggcctggagacggccgggggcgtcatgaccgtgctcatc
ccgaggaacaccaccatcccgaccaagaaggagcaggtcttctccacctactccgacaac
cagcccggcgtgctcatccaggtgtacgagggtgagagggcccggaccaaggacaacaac
ctgctcggcaagttcgagctctccggcatccctccggcgcccaggggcgttccccagatc
accgtgtgcttcgacatggacgccaacggcatcctgaacgtgtcggcagaggacaagacc
accggccagaagaacaagatcacaatcaccaacgacaagggccggttgagcaaggaggag
atcgagaagatggtgcaggaggccgagaagtacaaggccgaggacgaggagcacaagaag
aaggtggacgccaagaattcgctcgagaactacgcctacaacatgcgcaacaccatcagg
gacgacaagatcgcgtccaagctcccggaggccgacaagaagaagatcgacgaagccatc
gagggggccatcacctggctggacaacaaccagctcgccgaggttgacgagtttgaggac
aagatgaaggagctggagggcatctgcaaccccatcatcgccaagatgtaccagggcgcc
gctggccctgacatggccggtggcatggctgaggatgctccggcggccggcggcagtggt
gccggacccaagatcgaggaagtcgactaa

DBGET integrated database retrieval system