KEGG   Setaria italica (foxtail millet): 101764302Help
Entry
101764302         CDS       T02818                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03040  Spliceosome
sita04141  Protein processing in endoplasmic reticulum
sita04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101764302
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101764302
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101764302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sita01009]
    101764302
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sita03041]
    101764302
   03009 Ribosome biogenesis [BR:sita03009]
    101764302
   03110 Chaperones and folding catalysts [BR:sita03110]
    101764302
   04131 Membrane trafficking [BR:sita04131]
    101764302
   03051 Proteasome [BR:sita03051]
    101764302
   03029 Mitochondrial biogenesis [BR:sita03029]
    101764302
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101764302
Protein phosphatases and associated proteins [BR:sita01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101764302
Spliceosome [BR:sita03041]
 Complex B
  Other components
   Prp19 complex
    101764302
 Complex C
   Prp19-CDC5 complex
    101764302
Ribosome biogenesis [BR:sita03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101764302
Chaperones and folding catalysts [BR:sita03110]
 Heat shock proteins
  HSP70 / DNAK
   101764302
Membrane trafficking [BR:sita04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101764302
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101764302
Proteasome [BR:sita03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101764302
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101764302
Exosome [BR:sita04147]
 Exosomal proteins
  Proteins found in most exosomes
   101764302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 101764302
NCBI-ProteinID: XP_004981251
UniProt: K4A6V7
Position
IX
AA seq 648 aa AA seqDB search
MAPTKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK
NQVAMNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFS
AEEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF
DNRLVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDF
YSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDF
FNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVL
IPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQ
ITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHK
KKVEAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDSNQLAEVEEFE
DKMKELEGLCNPIIAKMYQGAGADMAGGMEDDAPAAPGGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaccaagggcgaggggccggcgatcggcatcgacctgggcaccacgtactcg
tgcgtcggcgtgtggcagcacgaccgcgtcgagatcatcgccaacgaccaggggaaccgt
accacgccgtcgtacgttgggttcaccgactccgagcgcctcatcggcgatgccgcgaag
aaccaggtcgccatgaaccccatcaacaccgtctttgatgctaagcgtcttatcggcaga
cggttttctgatgcttctgtccagagtgacattaagatgtggccgtacaaggttattcct
ggcccaggggataagcctatgattgtagtgcagtacaagggtgaggagaagcagttctct
gccgaagaaatttcttctatggttcttatcaagatgcgtgagattgctgaagcttacctt
ggattgaccataaagaatgctgtggttactgttcctgcttactttaatgattcccagagg
caggcaactaaggatgctggtgttattgccgggctcaatgtcatgcgtatcatcaatgag
ccaactgctgctgcaattgcctatggtcttgacaagaaagctactagtgttggtgagaag
aatgtccttatttttgaccttggtggtggcacttttgatgtttctctcctcactattgag
gagggtatatttgaggtgaaggccacagctggtgacactcaccttggtggggaggacttt
gacaaccgcttggtgaaccactttgtccaagagtttaagcggaaaaacaagaaggatatc
actgggaaccccagggctttgagaaggcttaggacttcatgtgagagggctaagaggaca
ctttcttccacagcgcagactacgattgaaattgattctctctacgagggcattgatttc
tattccaccatcacaagagccaggtttgaggaacttaacatggacctattcaggaagtgc
atggagcctgtggagaagtgcctgagggatgccaagatggataagagcactgtccatgat
gttgtccttgttggtggttcgactaggatccccaaagtccagcagctgctgcaggacttc
ttcaatggaaaggaactttgcaagagcatcaatcctgatgaagctgttgcctatggcgct
gccgttcaggctgctatccttagtggtgagggcaatgagaaggttcaggaccttctcctc
ctcgatgtgaccccactgtctcttggtcttgaaactgccggaggagtcatgactgtcctt
attccaaggaacaccaccattccaaccaagaaagagcaggtcttctccacctactcggat
aaccagcctggtgtgttgatccaggtttatgagggcgagaggacccggaccagggacaac
aatctccttgggaaatttgagctctctggaatcccccctgctcctaggggtgtccctcag
atcactgtatgctttgacatcgatgctaatggtattctgaatgtctctgctgaagacaag
acgactggacagaagaacaagatcaccatcaccaatgacaagggaaggctgagcaaggag
gacattgagaagatggtccaggatgcggagaagtacaagtctgaggatgaggagcacaag
aagaaggttgaggccaagaactccctggagaactatgcctacaacatgaggaacaccatc
caggatgaaaagattgcttccaagctgccagcagatgacaagaagaagattgaggatgct
gtcgagcaggcgatccagtggctggacagcaaccagcttgctgaggtcgaagagttcgag
gacaagatgaaggagctcgaaggcctctgcaaccccatcatcgccaagatgtaccagggc
gctggagctgacatggctggtggtatggaggatgatgctcctgctgctcctggtggtgct
ggccccaagattgaggaagtcgactaa

DBGET integrated database retrieval system